LRRC17 (leucine rich repeat containing 17)

Gene

• Entrez ID: 10234
• Gene name: Leucine rich repeat containing 17
• Gene symbol: LRRC17
• Synonyms (NCBI Gene): P37NB
• Chromosome: 7
• Chromosome location: 7q22.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017915	hsa-miR-335-5p	Microarray	18185580
MIRT025039	hsa-miR-181a-5p	Microarray	17612493
MIRT029536	hsa-miR-26b-5p	Microarray	19088304
MIRT1118995	hsa-miR-365	CLIP-seq
MIRT2438451	hsa-miR-1323	CLIP-seq
MIRT2438452	hsa-miR-3129-3p	CLIP-seq
MIRT2438453	hsa-miR-3591-3p	CLIP-seq
MIRT2438454	hsa-miR-548o	CLIP-seq
MIRT2438451	hsa-miR-1323	CLIP-seq
MIRT2438452	hsa-miR-3129-3p	CLIP-seq
MIRT2438453	hsa-miR-3591-3p	CLIP-seq
MIRT2438454	hsa-miR-548o	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001649	Process	Osteoblast differentiation	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0033687	Process	Osteoblast proliferation	ISS
GO:0038023	Function	Signaling receptor activity	IBA
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	ISS
GO:0048539	Process	Bone marrow development	IEA
GO:0048539	Process	Bone marrow development	ISS

Other IDs

• MIM: 618749
• HGNC: 16895
• e!Ensembl: ENSG00000128606

Protein

• UniProt ID: Q8N6Y2
• Protein name: Leucine-rich repeat-containing protein 17 (p37NB)
• Protein function: Involved in bone homeostasis. Acts as a negative regulator of RANKL-induced osteoclast precursor differentiation from bone marrow precursors (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	105 → 164	Leucine rich repeat	Repeat
  PF13855	LRR_8	292 → 351	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Expressed in osteoblast cell lines. Well expressed in ovary, heart, pancreas, skeletal muscle, lung, and fetal kidney and lung and only at the basal levels in the other tissues examined including adult kidney. More expressed in S-type
• Sequence:

  MRVVTIVILLCFCKAAELRKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYL
  HEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKI
  ESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQI
  PRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDST
  FCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHELKKLNLS
  SNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDNPWRCDYNIHY
  LYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDE
  WEKKHRDHTAKKQSVIITIVG

• Sequence length: 441

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bone Diseases Metabolic	Bone disease	Pubtator	36728938	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34373442, 37774061	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	39289672	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	8982252		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	8982252	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22682620		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	36155774	Associate	★☆☆☆☆ Found in Text Mining only