Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	10223
Gene name	Glycoprotein A33
Gene symbol	GPA33
Synonyms (NCBI Gene)	A33
Chromosome	1
Chromosome location	1q24.1
Summary	The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosyla

Show/Hide all (90)

miRTarBase ID	miRNA	Experiments
MIRT1028031	hsa-miR-1281	CLIP-seq
MIRT1028032	hsa-miR-1286	CLIP-seq
MIRT1028033	hsa-miR-1294	CLIP-seq
MIRT1028034	hsa-miR-1298	CLIP-seq
MIRT1028035	hsa-miR-185	CLIP-seq
MIRT1028036	hsa-miR-193a-3p	CLIP-seq
MIRT1028037	hsa-miR-193b	CLIP-seq
MIRT1028038	hsa-miR-2110	CLIP-seq
MIRT1028039	hsa-miR-214	CLIP-seq
MIRT1028040	hsa-miR-27a	CLIP-seq
MIRT1028041	hsa-miR-27b	CLIP-seq
MIRT1028042	hsa-miR-3619-5p	CLIP-seq
MIRT1028043	hsa-miR-3676	CLIP-seq
MIRT1028044	hsa-miR-3914	CLIP-seq
MIRT1028045	hsa-miR-4254	CLIP-seq
MIRT1028046	hsa-miR-4271	CLIP-seq
MIRT1028047	hsa-miR-4291	CLIP-seq
MIRT1028048	hsa-miR-4292	CLIP-seq
MIRT1028049	hsa-miR-4306	CLIP-seq
MIRT1028050	hsa-miR-4308	CLIP-seq
MIRT1028051	hsa-miR-4436a	CLIP-seq
MIRT1028052	hsa-miR-4642	CLIP-seq
MIRT1028053	hsa-miR-4644	CLIP-seq
MIRT1028054	hsa-miR-4681	CLIP-seq
MIRT1028055	hsa-miR-4700-3p	CLIP-seq
MIRT1028056	hsa-miR-4720-5p	CLIP-seq
MIRT1028057	hsa-miR-4722-5p	CLIP-seq
MIRT1028058	hsa-miR-4725-3p	CLIP-seq
MIRT1028059	hsa-miR-4799-3p	CLIP-seq
MIRT1028060	hsa-miR-513a-5p	CLIP-seq
MIRT1028061	hsa-miR-576-3p	CLIP-seq
MIRT1028062	hsa-miR-664	CLIP-seq
MIRT1028063	hsa-miR-761	CLIP-seq
MIRT1028064	hsa-miR-873	CLIP-seq
MIRT1028065	hsa-miR-885-3p	CLIP-seq
MIRT1028066	hsa-miR-892b	CLIP-seq
MIRT1028067	hsa-miR-922	CLIP-seq
MIRT2004957	hsa-miR-1	CLIP-seq
MIRT1028032	hsa-miR-1286	CLIP-seq
MIRT2004958	hsa-miR-206	CLIP-seq
MIRT2004959	hsa-miR-3127-5p	CLIP-seq
MIRT2004960	hsa-miR-3158-3p	CLIP-seq
MIRT2004961	hsa-miR-3673	CLIP-seq
MIRT1028044	hsa-miR-3914	CLIP-seq
MIRT2004962	hsa-miR-4270	CLIP-seq
MIRT1028051	hsa-miR-4436a	CLIP-seq
MIRT2004963	hsa-miR-4441	CLIP-seq
MIRT1028057	hsa-miR-4722-5p	CLIP-seq
MIRT2004964	hsa-miR-613	CLIP-seq
MIRT1028064	hsa-miR-873	CLIP-seq
MIRT1028032	hsa-miR-1286	CLIP-seq
MIRT1028044	hsa-miR-3914	CLIP-seq
MIRT1028057	hsa-miR-4722-5p	CLIP-seq
MIRT1028064	hsa-miR-873	CLIP-seq
MIRT1028032	hsa-miR-1286	CLIP-seq
MIRT1028044	hsa-miR-3914	CLIP-seq
MIRT1028057	hsa-miR-4722-5p	CLIP-seq
MIRT1028064	hsa-miR-873	CLIP-seq
MIRT2541631	hsa-miR-103a	CLIP-seq
MIRT2541632	hsa-miR-107	CLIP-seq
MIRT2541633	hsa-miR-1914	CLIP-seq
MIRT2541634	hsa-miR-1915	CLIP-seq
MIRT1028039	hsa-miR-214	CLIP-seq
MIRT2541635	hsa-miR-2861	CLIP-seq
MIRT1028042	hsa-miR-3619-5p	CLIP-seq
MIRT2541636	hsa-miR-3918	CLIP-seq
MIRT2541637	hsa-miR-3944-5p	CLIP-seq
MIRT2541638	hsa-miR-4433	CLIP-seq
MIRT2541639	hsa-miR-4481	CLIP-seq
MIRT2541640	hsa-miR-4512	CLIP-seq
MIRT2541641	hsa-miR-4685-5p	CLIP-seq
MIRT1028057	hsa-miR-4722-5p	CLIP-seq
MIRT2541642	hsa-miR-4745-5p	CLIP-seq
MIRT1028063	hsa-miR-761	CLIP-seq
MIRT2541631	hsa-miR-103a	CLIP-seq
MIRT2541632	hsa-miR-107	CLIP-seq
MIRT2541633	hsa-miR-1914	CLIP-seq
MIRT2541634	hsa-miR-1915	CLIP-seq
MIRT1028039	hsa-miR-214	CLIP-seq
MIRT2541635	hsa-miR-2861	CLIP-seq
MIRT1028042	hsa-miR-3619-5p	CLIP-seq
MIRT2541636	hsa-miR-3918	CLIP-seq
MIRT2541637	hsa-miR-3944-5p	CLIP-seq
MIRT2541638	hsa-miR-4433	CLIP-seq
MIRT2541639	hsa-miR-4481	CLIP-seq
MIRT2541640	hsa-miR-4512	CLIP-seq
MIRT2541641	hsa-miR-4685-5p	CLIP-seq
MIRT1028057	hsa-miR-4722-5p	CLIP-seq
MIRT2541642	hsa-miR-4745-5p	CLIP-seq
MIRT1028063	hsa-miR-761	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
KLF4	Activation	19551868

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21044950, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9012807
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	TAS	9012807
GO:0070062	Component	Extracellular exosome	HDA	11487543

MIM	HGNC	e!Ensembl
602171	4445	ENSG00000143167

Q99795

Protein name

Cell surface A33 antigen (Glycoprotein A33)

Protein function

May play a role in cell-cell recognition and signaling.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	25 → 138	Immunoglobulin V-set domain	Domain
PF13927	Ig_3	143 → 215		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in normal gastrointestinal epithelium and in 95% of colon cancers.

Sequence

MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDK
LLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVS
LMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNI
LNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVALYVG
IAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNREAYEEPPEQLRELSREREEEDD
YRQEEQRSTGRESPDHLDQ

Sequence length

319

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHURG-STRAUSS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	20531296, 26398937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	26398937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	16473928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Birdshot Chorioretinopathy	Birdshot chorioretinopathy	Pubtator	34727153	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22718791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35392800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17786329, 19551868, 22718791, 26398937, 29866746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26090413, 28705917, 30082472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19551868, 19837982, 28226180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	17227111	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	36862897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17786329, 18298330, 19551868, 22718791, 26398937, 29866746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26090413, 28705917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30429889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28226180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37349623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29866746		★★★★★ ★☆☆☆☆ Found in Text Mining only

GPA33 (glycoprotein A33)