KLRG1 (killer cell lectin like receptor G1)

Gene

• Entrez ID: 10219
• Gene name: Killer cell lectin like receptor G1
• Gene symbol: KLRG1
• Synonyms (NCBI Gene): 2F1, CLEC15A, MAFA, MAFA-2F1, MAFA-L, MAFA-LIKE
• Chromosome: 12
• Chromosome location: 12p13.31
• Summary: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT036992	hsa-miR-877-3p	CLASH	23622248
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099390	hsa-miR-1184	CLIP-seq
MIRT1099391	hsa-miR-150	CLIP-seq
MIRT1099392	hsa-miR-1915	CLIP-seq
MIRT1099393	hsa-miR-3135b	CLIP-seq
MIRT1099394	hsa-miR-3200-5p	CLIP-seq
MIRT1099395	hsa-miR-365	CLIP-seq
MIRT1099396	hsa-miR-3652	CLIP-seq
MIRT1099397	hsa-miR-371-5p	CLIP-seq
MIRT1099398	hsa-miR-4251	CLIP-seq
MIRT1099399	hsa-miR-4329	CLIP-seq
MIRT1099400	hsa-miR-4418	CLIP-seq
MIRT1099401	hsa-miR-4420	CLIP-seq
MIRT1099402	hsa-miR-4430	CLIP-seq
MIRT1099403	hsa-miR-4713-5p	CLIP-seq
MIRT1099404	hsa-miR-4726-3p	CLIP-seq
MIRT1099405	hsa-miR-4729	CLIP-seq
MIRT1099406	hsa-miR-509-3-5p	CLIP-seq
MIRT1099407	hsa-miR-509-5p	CLIP-seq
MIRT1099408	hsa-miR-532-3p	CLIP-seq
MIRT1099409	hsa-miR-539	CLIP-seq
MIRT1099410	hsa-miR-633	CLIP-seq
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099391	hsa-miR-150	CLIP-seq
MIRT1099392	hsa-miR-1915	CLIP-seq
MIRT1099393	hsa-miR-3135b	CLIP-seq
MIRT1099396	hsa-miR-3652	CLIP-seq
MIRT1099402	hsa-miR-4430	CLIP-seq
MIRT1099403	hsa-miR-4713-5p	CLIP-seq
MIRT1099404	hsa-miR-4726-3p	CLIP-seq
MIRT1099408	hsa-miR-532-3p	CLIP-seq
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099390	hsa-miR-1184	CLIP-seq
MIRT2258177	hsa-miR-1343	CLIP-seq
MIRT1099391	hsa-miR-150	CLIP-seq
MIRT1099392	hsa-miR-1915	CLIP-seq
MIRT1099393	hsa-miR-3135b	CLIP-seq
MIRT1099396	hsa-miR-3652	CLIP-seq
MIRT1099397	hsa-miR-371-5p	CLIP-seq
MIRT2258178	hsa-miR-378g	CLIP-seq
MIRT2258179	hsa-miR-4307	CLIP-seq
MIRT2258180	hsa-miR-431	CLIP-seq
MIRT1099400	hsa-miR-4418	CLIP-seq
MIRT1099402	hsa-miR-4430	CLIP-seq
MIRT2258181	hsa-miR-4437	CLIP-seq
MIRT2258182	hsa-miR-455-3p	CLIP-seq
MIRT2258183	hsa-miR-4670-5p	CLIP-seq
MIRT2258184	hsa-miR-4674	CLIP-seq
MIRT1099403	hsa-miR-4713-5p	CLIP-seq
MIRT2258185	hsa-miR-4716-5p	CLIP-seq
MIRT1099404	hsa-miR-4726-3p	CLIP-seq
MIRT1099406	hsa-miR-509-3-5p	CLIP-seq
MIRT1099407	hsa-miR-509-5p	CLIP-seq
MIRT1099408	hsa-miR-532-3p	CLIP-seq
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099391	hsa-miR-150	CLIP-seq
MIRT1099392	hsa-miR-1915	CLIP-seq
MIRT1099393	hsa-miR-3135b	CLIP-seq
MIRT1099396	hsa-miR-3652	CLIP-seq
MIRT1099400	hsa-miR-4418	CLIP-seq
MIRT1099402	hsa-miR-4430	CLIP-seq
MIRT1099403	hsa-miR-4713-5p	CLIP-seq
MIRT1099404	hsa-miR-4726-3p	CLIP-seq
MIRT1099406	hsa-miR-509-3-5p	CLIP-seq
MIRT1099407	hsa-miR-509-5p	CLIP-seq
MIRT1099408	hsa-miR-532-3p	CLIP-seq
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099390	hsa-miR-1184	CLIP-seq
MIRT1099397	hsa-miR-371-5p	CLIP-seq
MIRT1099400	hsa-miR-4418	CLIP-seq
MIRT1099406	hsa-miR-509-3-5p	CLIP-seq
MIRT1099407	hsa-miR-509-5p	CLIP-seq
MIRT1099389	hsa-miR-103b	CLIP-seq
MIRT1099390	hsa-miR-1184	CLIP-seq
MIRT1099397	hsa-miR-371-5p	CLIP-seq
MIRT1099400	hsa-miR-4418	CLIP-seq
MIRT1099406	hsa-miR-509-3-5p	CLIP-seq
MIRT1099407	hsa-miR-509-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183, 32814053
GO:0005886	Component	Plasma membrane	IEA
GO:0006954	Process	Inflammatory response	TAS	9842918
GO:0006968	Process	Cellular defense response	TAS	9842918
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9842918
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9842918
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	TAS	9765598
GO:0038023	Function	Signaling receptor activity	TAS	9765598
GO:0045087	Process	Innate immune response	IEA

Other IDs

• MIM: 604874
• HGNC: 6380
• e!Ensembl: ENSG00000139187

Protein

• UniProt ID: Q96E93
• Protein name: Killer cell lectin-like receptor subfamily G member 1 (C-type lectin domain family 15 member A) (ITIM-containing receptor MAFA-L) (MAFA-like receptor) (Mast cell function-associated antigen)
• Protein function: Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expressio
• PDB: 3FF7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	92 → 186	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells. {ECO:0000269|PubMed:15879103, ECO:0000269|PubMed:9842918}.
• Sequence:

  MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWIL
  CQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMS
  LLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPL
  HWVCKKCPFADQALF

• Sequence length: 195

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Angina Pectoris	Angina pectoris	Pubtator	26823790	Inhibit	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31823769		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31823769		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27424220, 28076899, 31699819		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	27424220, 28076899	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	24894771		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30858925		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34386013	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	39294340	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	36059513	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24022692		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28437578		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30858925		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32393998	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35192548	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	30905683		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28850267		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	31699819	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	26032326	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	24022692		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	31326977		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37657842	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	40147444	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	3513178	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	31255417	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	31255417	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	33298584	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35981786	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19440200	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19440200		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	34226281	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	20132662	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30858925		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30858925		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30858925		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26611787	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	26611787		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	36096526	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37054944	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34667129	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	26823790	Inhibit	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	35131904	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17617594, 30858925		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36472588	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	27424220		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	27424220	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	27424220		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	31255417		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	28076899	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren`s Syndrome	Sjogren`s Syndrome	GWASCAT_DG	28076899		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35413989	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis Anterior	Anterior uveitis	Pubtator	33807229	Associate	★☆☆☆☆ Found in Text Mining only