Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10218
Gene name	Angiopoietin like 7
Gene symbol	ANGPTL7
Synonyms (NCBI Gene)	AngXCDT6dJ647M16.1
Chromosome	1
Chromosome location	1p36.22

Show/Hide all (60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022433	hsa-miR-124-3p	Microarray	18668037
MIRT645301	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT645300	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT645299	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT645298	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT645297	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT645296	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT645295	hsa-miR-520f-5p	HITS-CLIP	23824327
MIRT645294	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT645293	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT645292	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT645291	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT645290	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT645289	hsa-miR-188-3p	HITS-CLIP	23824327
MIRT645288	hsa-miR-1260a	HITS-CLIP	23824327
MIRT645287	hsa-miR-1260b	HITS-CLIP	23824327
MIRT645286	hsa-miR-3156-3p	HITS-CLIP	23824327
MIRT645285	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT645284	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT645283	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT645282	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT645281	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT732959	hsa-miR-1270	MicroarrayRNA-seqqRT-PCR	34070163
MIRT645301	hsa-miR-141-3p	HITS-CLIP	23824327
MIRT645300	hsa-miR-200a-3p	HITS-CLIP	23824327
MIRT645299	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT645298	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT645297	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT645296	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT645295	hsa-miR-520f-5p	HITS-CLIP	23824327
MIRT645294	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT645293	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT645292	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT645291	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT645290	hsa-miR-6794-3p	HITS-CLIP	23824327
MIRT645289	hsa-miR-188-3p	HITS-CLIP	23824327
MIRT645288	hsa-miR-1260a	HITS-CLIP	23824327
MIRT645287	hsa-miR-1260b	HITS-CLIP	23824327
MIRT645286	hsa-miR-3156-3p	HITS-CLIP	23824327
MIRT645285	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT645284	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT645283	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT645282	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT645281	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT781559	hsa-miR-1273f	CLIP-seq
MIRT781560	hsa-miR-143	CLIP-seq
MIRT781561	hsa-miR-3609	CLIP-seq
MIRT781562	hsa-miR-3674	CLIP-seq
MIRT781563	hsa-miR-4708-5p	CLIP-seq
MIRT781564	hsa-miR-4770	CLIP-seq
MIRT781565	hsa-miR-488	CLIP-seq
MIRT781566	hsa-miR-520d-5p	CLIP-seq
MIRT781567	hsa-miR-520g	CLIP-seq
MIRT781568	hsa-miR-520h	CLIP-seq
MIRT781569	hsa-miR-524-5p	CLIP-seq
MIRT781570	hsa-miR-548ah	CLIP-seq
MIRT1930690	hsa-miR-2113	CLIP-seq
MIRT2171290	hsa-miR-1305	CLIP-seq
MIRT2171291	hsa-miR-4328	CLIP-seq
MIRT2171292	hsa-miR-4724-3p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25910212
GO:0005576	Component	Extracellular region	IDA	11682471
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0006979	Process	Response to oxidative stress	TAS	8026862
GO:0007596	Process	Blood coagulation	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0042802	Function	Identical protein binding	IDA	11682471
GO:1901346	Process	Negative regulation of vasculature development involved in avascular cornea development in camera-type eye	IMP	25622036
GO:1903053	Process	Regulation of extracellular matrix organization	IMP	21199193

MIM	HGNC	e!Ensembl
618517	24078	ENSG00000171819

O43827

Protein name

Angiopoietin-related protein 7 (Angiopoietin-like factor) (Angiopoietin-like protein 7) (Cornea-derived transcript 6 protein)

Protein function

Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00147	Fibrinogen_C	127 → 342	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the cornea (at protein level) (PubMed:11682471). Expression is restricted to the stromal layer (PubMed:11682471). Also detected at the junction between the corneal stromal layer and the conjuctiva. Not detected in t

Sequence

MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLS
SLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTV
TQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSG
LVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVL
GNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTD
SNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP

Sequence length

346

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	25854806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34685578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28264047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	18421092, 21199193, 28264047, 31835268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	LHGDN	18421092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	21199193, 28264047, 32369491, 37220876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	32369491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	32369491, 32913388, 37220876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	18421092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31302653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	28264047, 36078120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21500188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25854806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17695521, 31835268		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12792978, 17695521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12792978, 17695521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28264047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28264047	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31835268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	36017324	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36399105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ANGPTL7 (angiopoietin like 7)