Gene Gene information from NCBI Gene database.
Entrez ID 10214
Gene name SSX family member 3
Gene symbol SSX3
Synonyms (NCBI Gene)
CT5.3
Chromosome X
Chromosome location Xp11.23
Summary The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune respons
miRNA miRNA information provided by mirtarbase database.
7
miRTarBase ID miRNA Experiments Reference
MIRT2117949 hsa-miR-1273g CLIP-seq
MIRT2117950 hsa-miR-147 CLIP-seq
MIRT2117951 hsa-miR-3650 CLIP-seq
MIRT2117952 hsa-miR-599 CLIP-seq
MIRT2339948 hsa-miR-3126-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300325 11337 ENSG00000165584
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99909
Protein name Protein SSX3 (Cancer/testis antigen 5.3) (CT5.3)
Protein function Could act as a modulator of transcription.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09514 SSXRD 158 187 SSXRD motif Motif
Sequence
MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTK
LGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEG
NVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEI
SDPEEDD
E
Sequence length 188
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Transcriptional misregulation in cancer  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
NEUROTIC DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Azoospermia Nonobstructive Nonobstructive azoospermia Pubtator 36017582 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Male Male breast neoplasms Pubtator 30850364 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma Pubtator 38050902 Associate
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 24645645
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 9639388
★☆☆☆☆
Found in Text Mining only
synovial sarcoma Synovial sarcoma BEFREE 8697803
★☆☆☆☆
Found in Text Mining only
Testicular Germ Cell Tumor Testicular germ cell tumor Pubtator 21706474 Associate
★☆☆☆☆
Found in Text Mining only