Gene Gene information from NCBI Gene database.
Entrez ID 10206
Gene name Tripartite motif containing 13
Gene symbol TRIM13
Synonyms (NCBI Gene)
CARDLEU5LEU5RFP2RNF77
Chromosome 13
Chromosome location 13q14.2
Summary This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 13 within the minimal deletion re
miRNA miRNA information provided by mirtarbase database.
740
miRTarBase ID miRNA Experiments Reference
MIRT028784 hsa-miR-26b-5p Microarray 19088304
MIRT438078 hsa-miR-137 Luciferase reporter assayqRT-PCRWestern blotmicroarray 23934188
MIRT438078 hsa-miR-137 Luciferase reporter assayqRT-PCRWestern blotmicroarray 23934188
MIRT438078 hsa-miR-137 Luciferase reporter assayqRT-PCRWestern blotmicroarray 23934188
MIRT438078 hsa-miR-137 Luciferase reporter assayqRT-PCRWestern blotmicroarray 23934188
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
38
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0003713 Function Transcription coactivator activity IDA 23077300
GO:0004842 Function Ubiquitin-protein transferase activity IDA 17314412
GO:0005515 Function Protein binding IPI 17314412, 21333377, 22178386, 25416956
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605661 9976 ENSG00000204977
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60858
Protein name E3 ubiquitin-protein ligase TRIM13 (EC 2.3.2.27) (B-cell chronic lymphocytic leukemia tumor suppressor Leu5) (Leukemia-associated protein 5) (Putative tumor suppressor RFP2) (RING finger protein 77) (RING-type E3 ubiquitin transferase TRIM13) (Ret finger
Protein function Endoplasmic reticulum (ER) membrane anchored E3 ligase involved in the retrotranslocation and turnover of membrane and secretory proteins from the ER through a set of processes named ER-associated degradation (ERAD). This process acts on misfold
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13445 zf-RING_UBOX 10 55 RING-type zinc-finger Domain
PF00643 zf-B_box 89 131 B-box zinc finger Domain
Sequence
MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKE
TSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATR
GEHTKHVFCSI
EDAYAQERDAFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSD
KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFK
DVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP
QDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATWKGCLSNFSSYLTK
TADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL
Sequence length 407
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    ER Quality Control Compartment (ERQC)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
TREATMENT-RESISTANT HYPERTENSION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Cerebrovascular Accidents Stroke BEFREE 24368200
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 31571160, 31671855
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 27009300, 27865176, 28888074, 28988742, 29288188, 29417201, 29633386, 29716633, 29797659, 30006739, 30120708, 30539476, 30651858, 30666425, 31282760
View all (3 more)
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 25174587
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 31640756
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 31028190
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 29633386, 30006739, 30120708, 30666425, 31335716, 31554741
★☆☆☆☆
Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma B-cell Lymphoma BEFREE 30006739, 30735463
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 30632631
★☆☆☆☆
Found in Text Mining only
Adult Medulloblastoma Medulloblastoma BEFREE 30249594
★☆☆☆☆
Found in Text Mining only