Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10203
Gene name	Calcitonin receptor like receptor
Gene symbol	CALCRL
Synonyms (NCBI Gene)	CGRPRCRLRLMPHM8
Chromosome	2
Chromosome location	2q32.1

153

Show/Hide all (153)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022193	hsa-miR-124-3p	Microarray	18668037
MIRT858953	hsa-miR-1226	CLIP-seq
MIRT858954	hsa-miR-1244	CLIP-seq
MIRT858955	hsa-miR-128	CLIP-seq
MIRT858956	hsa-miR-1287	CLIP-seq
MIRT858957	hsa-miR-129-5p	CLIP-seq
MIRT858958	hsa-miR-153	CLIP-seq
MIRT858959	hsa-miR-199a-3p	CLIP-seq
MIRT858960	hsa-miR-199b-3p	CLIP-seq
MIRT858961	hsa-miR-214	CLIP-seq
MIRT858962	hsa-miR-2277-3p	CLIP-seq
MIRT858963	hsa-miR-27a	CLIP-seq
MIRT858964	hsa-miR-27b	CLIP-seq
MIRT858965	hsa-miR-3120-3p	CLIP-seq
MIRT858966	hsa-miR-3123	CLIP-seq
MIRT858967	hsa-miR-3129-5p	CLIP-seq
MIRT858968	hsa-miR-3135b	CLIP-seq
MIRT858969	hsa-miR-3619-5p	CLIP-seq
MIRT858970	hsa-miR-3650	CLIP-seq
MIRT858971	hsa-miR-374a	CLIP-seq
MIRT858972	hsa-miR-374b	CLIP-seq
MIRT858973	hsa-miR-3925-5p	CLIP-seq
MIRT858974	hsa-miR-4267	CLIP-seq
MIRT858975	hsa-miR-4282	CLIP-seq
MIRT858976	hsa-miR-4530	CLIP-seq
MIRT858977	hsa-miR-4699-3p	CLIP-seq
MIRT858978	hsa-miR-4703-3p	CLIP-seq
MIRT858979	hsa-miR-4761-5p	CLIP-seq
MIRT858980	hsa-miR-4803	CLIP-seq
MIRT858981	hsa-miR-496	CLIP-seq
MIRT858982	hsa-miR-513a-3p	CLIP-seq
MIRT858983	hsa-miR-514	CLIP-seq
MIRT858984	hsa-miR-514b-3p	CLIP-seq
MIRT858985	hsa-miR-545	CLIP-seq
MIRT858986	hsa-miR-563	CLIP-seq
MIRT858987	hsa-miR-577	CLIP-seq
MIRT858988	hsa-miR-624	CLIP-seq
MIRT858989	hsa-miR-761	CLIP-seq
MIRT858990	hsa-miR-892b	CLIP-seq
MIRT1546055	hsa-miR-205	CLIP-seq
MIRT1546056	hsa-miR-500a	CLIP-seq
MIRT1954984	hsa-miR-1253	CLIP-seq
MIRT1546055	hsa-miR-205	CLIP-seq
MIRT1954985	hsa-miR-2053	CLIP-seq
MIRT1954986	hsa-miR-4659a-3p	CLIP-seq
MIRT1954987	hsa-miR-4659b-3p	CLIP-seq
MIRT1954988	hsa-miR-4775	CLIP-seq
MIRT1546056	hsa-miR-500a	CLIP-seq
MIRT1954989	hsa-miR-513c	CLIP-seq
MIRT1954990	hsa-miR-514b-5p	CLIP-seq
MIRT1954991	hsa-miR-569	CLIP-seq
MIRT1954992	hsa-miR-580	CLIP-seq
MIRT1954993	hsa-miR-590-3p	CLIP-seq
MIRT2192706	hsa-miR-101	CLIP-seq
MIRT2192707	hsa-miR-144	CLIP-seq
MIRT2192708	hsa-miR-4760-3p	CLIP-seq
MIRT858953	hsa-miR-1226	CLIP-seq
MIRT858956	hsa-miR-1287	CLIP-seq
MIRT858968	hsa-miR-3135b	CLIP-seq
MIRT858974	hsa-miR-4267	CLIP-seq
MIRT858990	hsa-miR-892b	CLIP-seq
MIRT2446093	hsa-miR-193a-5p	CLIP-seq
MIRT2446094	hsa-miR-3115	CLIP-seq
MIRT858985	hsa-miR-545	CLIP-seq
MIRT858953	hsa-miR-1226	CLIP-seq
MIRT2495857	hsa-miR-1260	CLIP-seq
MIRT2495858	hsa-miR-1260b	CLIP-seq
MIRT858956	hsa-miR-1287	CLIP-seq
MIRT2495859	hsa-miR-188-3p	CLIP-seq
MIRT2495860	hsa-miR-218	CLIP-seq
MIRT2495861	hsa-miR-219-5p	CLIP-seq
MIRT2495862	hsa-miR-2964a-5p	CLIP-seq
MIRT2495863	hsa-miR-3140-3p	CLIP-seq
MIRT2495864	hsa-miR-3156-3p	CLIP-seq
MIRT2495865	hsa-miR-3167	CLIP-seq
MIRT2495866	hsa-miR-323-3p	CLIP-seq
MIRT2495867	hsa-miR-3607-5p	CLIP-seq
MIRT2495868	hsa-miR-3611	CLIP-seq
MIRT2495869	hsa-miR-3614-5p	CLIP-seq
MIRT2495870	hsa-miR-3692	CLIP-seq
MIRT2495871	hsa-miR-376c	CLIP-seq
MIRT2495872	hsa-miR-425	CLIP-seq
MIRT858974	hsa-miR-4267	CLIP-seq
MIRT2495873	hsa-miR-4269	CLIP-seq
MIRT2495874	hsa-miR-4445	CLIP-seq
MIRT2495875	hsa-miR-4446-5p	CLIP-seq
MIRT2495876	hsa-miR-4487	CLIP-seq
MIRT2495877	hsa-miR-4493	CLIP-seq
MIRT2495878	hsa-miR-4514	CLIP-seq
MIRT2495879	hsa-miR-4692	CLIP-seq
MIRT2495880	hsa-miR-4735-5p	CLIP-seq
MIRT2495881	hsa-miR-4742-5p	CLIP-seq
MIRT2495882	hsa-miR-4764-5p	CLIP-seq
MIRT2495883	hsa-miR-4778-3p	CLIP-seq
MIRT2495884	hsa-miR-4782-3p	CLIP-seq
MIRT2495885	hsa-miR-508-3p	CLIP-seq
MIRT2495886	hsa-miR-515-5p	CLIP-seq
MIRT2495887	hsa-miR-520d-5p	CLIP-seq
MIRT2495888	hsa-miR-524-5p	CLIP-seq
MIRT2495889	hsa-miR-603	CLIP-seq
MIRT2495890	hsa-miR-636	CLIP-seq
MIRT2495891	hsa-miR-876-5p	CLIP-seq
MIRT858953	hsa-miR-1226	CLIP-seq
MIRT2495857	hsa-miR-1260	CLIP-seq
MIRT2495858	hsa-miR-1260b	CLIP-seq
MIRT2677212	hsa-miR-1276	CLIP-seq
MIRT858956	hsa-miR-1287	CLIP-seq
MIRT2495859	hsa-miR-188-3p	CLIP-seq
MIRT2677213	hsa-miR-204	CLIP-seq
MIRT1546055	hsa-miR-205	CLIP-seq
MIRT2677214	hsa-miR-211	CLIP-seq
MIRT2495860	hsa-miR-218	CLIP-seq
MIRT2495861	hsa-miR-219-5p	CLIP-seq
MIRT2495862	hsa-miR-2964a-5p	CLIP-seq
MIRT2495863	hsa-miR-3140-3p	CLIP-seq
MIRT2495864	hsa-miR-3156-3p	CLIP-seq
MIRT2495865	hsa-miR-3167	CLIP-seq
MIRT2677215	hsa-miR-3189-5p	CLIP-seq
MIRT2495866	hsa-miR-323-3p	CLIP-seq
MIRT2495869	hsa-miR-3614-5p	CLIP-seq
MIRT2677216	hsa-miR-3684	CLIP-seq
MIRT2495870	hsa-miR-3692	CLIP-seq
MIRT2495871	hsa-miR-376c	CLIP-seq
MIRT2677217	hsa-miR-4260	CLIP-seq
MIRT858974	hsa-miR-4267	CLIP-seq
MIRT2677218	hsa-miR-4311	CLIP-seq
MIRT2677219	hsa-miR-4426	CLIP-seq
MIRT2495874	hsa-miR-4445	CLIP-seq
MIRT2495875	hsa-miR-4446-5p	CLIP-seq
MIRT2495876	hsa-miR-4487	CLIP-seq
MIRT2677220	hsa-miR-4647	CLIP-seq
MIRT2677221	hsa-miR-4662b	CLIP-seq
MIRT2495880	hsa-miR-4735-5p	CLIP-seq
MIRT2677222	hsa-miR-4755-5p	CLIP-seq
MIRT2677223	hsa-miR-4758-3p	CLIP-seq
MIRT2495882	hsa-miR-4764-5p	CLIP-seq
MIRT1954988	hsa-miR-4775	CLIP-seq
MIRT2495884	hsa-miR-4782-3p	CLIP-seq
MIRT2677224	hsa-miR-486-3p	CLIP-seq
MIRT2495885	hsa-miR-508-3p	CLIP-seq
MIRT2495886	hsa-miR-515-5p	CLIP-seq
MIRT2495887	hsa-miR-520d-5p	CLIP-seq
MIRT2495888	hsa-miR-524-5p	CLIP-seq
MIRT2677225	hsa-miR-548a-3p	CLIP-seq
MIRT2677226	hsa-miR-548e	CLIP-seq
MIRT2677227	hsa-miR-548f	CLIP-seq
MIRT2677228	hsa-miR-583	CLIP-seq
MIRT1954993	hsa-miR-590-3p	CLIP-seq
MIRT2495889	hsa-miR-603	CLIP-seq
MIRT2677229	hsa-miR-623	CLIP-seq
MIRT2677230	hsa-miR-635	CLIP-seq
MIRT2495890	hsa-miR-636	CLIP-seq
MIRT2495891	hsa-miR-876-5p	CLIP-seq

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IDA	20596610
GO:0001605	Function	Adrenomedullin receptor activity	IBA
GO:0001605	Function	Adrenomedullin receptor activity	IDA	9620797, 32296767
GO:0001605	Function	Adrenomedullin receptor activity	IPI	9620797, 10882736, 20074556, 22102369
GO:0001635	Function	Calcitonin gene-related peptide receptor activity	IBA
GO:0001635	Function	Calcitonin gene-related peptide receptor activity	IDA	9620797, 33602864
GO:0001635	Function	Calcitonin gene-related peptide receptor activity	IEA
GO:0001635	Function	Calcitonin gene-related peptide receptor activity	IPI	9620797, 10882736
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	7818539
GO:0004948	Function	Calcitonin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	16293613, 20596610, 20826335, 22102369, 23597562, 30115739, 30209400, 33602864
GO:0005737	Component	Cytoplasm	IDA	10882736
GO:0005764	Component	Lysosome	IDA	10882736
GO:0005768	Component	Endosome	IDA	10882736
GO:0005783	Component	Endoplasmic reticulum	IDA	10882736
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9620797
GO:0005886	Component	Plasma membrane	IDA	10882736, 18039931
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7818539
GO:0006816	Process	Calcium ion transport	IDA	10882736
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	7818539
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	9620797, 32296767, 33602864
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IPI	9620797, 10882736, 20074556, 22102369
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	NAS	21649645
GO:0007507	Process	Heart development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0015031	Process	Protein transport	IDA	9620797
GO:0016020	Component	Membrane	IEA
GO:0031623	Process	Receptor internalization	IDA	10882736, 20074556
GO:0048659	Process	Smooth muscle cell proliferation	IEA
GO:0071329	Process	Cellular response to sucrose stimulus	IDA	10882736
GO:1903143	Component	Adrenomedullin receptor complex	IDA	9620797, 10882736, 20074556, 22102369
GO:1903143	Component	Adrenomedullin receptor complex	IPI	22102369
GO:1903143	Component	Adrenomedullin receptor complex	ISS
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1990406	Component	CGRP receptor complex	IDA	9620797, 10882736
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IDA	9620797, 33602864
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IPI	9620797, 10882736
GO:1990409	Function	Adrenomedullin binding	IPI	20074556, 22102369
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IDA	32296767
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IPI	9620797, 10882736, 20074556, 22102369
GO:1990410	Process	Adrenomedullin receptor signaling pathway	NAS	21649645
GO:1990874	Process	Vascular associated smooth muscle cell proliferation	IEA

MIM	HGNC	e!Ensembl
114190	16709	ENSG00000064989

Q16602

Protein name

Calcitonin gene-related peptide type 1 receptor (CGRP type 1 receptor) (Calcitonin receptor-like receptor) (CRLR)

Protein function

G protein-coupled receptor which specificity is determined by its interaction with receptor-activity-modifying proteins (RAMPs) (PubMed:32296767, PubMed:33602864, PubMed:8626685). Together with RAMP1, form the receptor complex for calcitonin-gen

PDB

3AQF , 3N7P , 3N7R , 3N7S , 4RWF , 4RWG , 5V6Y , 6D1U , 6E3Y , 6UMG , 6UUN , 6UUS , 6UVA , 6V2E , 6ZHO , 6ZIS , 7KNT , 7KNU , 7P0F , 7P0I , 8AX5 , 8AX6 , 8AX7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02793	HRM	62 → 130	Hormone receptor domain	Family
PF00002	7tm_2	138 → 380	7 transmembrane receptor (Secretin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in the lung and heart. {ECO:0000269|PubMed:8626685}.

Sequence

MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQA
EGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRT
WTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNL
FFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKI
AEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN

Sequence length

461

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Vascular smooth muscle contraction		G alpha (s) signalling events Calcitonin-like ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Lymphatic malformation 8	Pathogenic	rs1574226259	RCV001003344	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDROPS FETALIS, NON-IMMUNE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (52)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	17102095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	28030866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	33413630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	19898635, 22933837		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17290391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	32507125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	35806402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10555038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15547717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36785674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23969937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22400488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	15917349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11972292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17878224		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	38602103	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	16622024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	17374397		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Gestational	Gestational diabetes	Pubtator	28666334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	38241313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	14717924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	BEFREE	30274796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	33602248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22400488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15797661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	25239601, 28130400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	19898635, 22933837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31000793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11943713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11943713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	14747444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis, Non-Immune	Hydrops Fetalis	BEFREE	30115739		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperoxia	Hyperoxia	Pubtator	34911614	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15797661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	15797661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33413630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	20954838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	34655717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31015209, 34559198, 34655717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30674976, 31182782, 31756985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28856910, 31182782, 31756985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	32049005, 36429413, 39497430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	33602248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15547717, 17363587, 19610056, 26762744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15315911		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	25856673	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma	Pheochromocytoma	BEFREE	17102095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	19898635, 22933837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16622024, 19210874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	17021138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	10777702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	28904253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CALCRL (calcitonin receptor like receptor)