DHRS2 (dehydrogenase/reductase 2)

Gene

• Entrez ID: 10202
• Gene name: Dehydrogenase/reductase 2
• Gene symbol: DHRS2
• Synonyms (NCBI Gene): HEP27, SDR25C1
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members of this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT934930	hsa-miR-1226	CLIP-seq
MIRT934931	hsa-miR-29a	CLIP-seq
MIRT934932	hsa-miR-29b	CLIP-seq
MIRT934933	hsa-miR-29c	CLIP-seq
MIRT934934	hsa-miR-330-3p	CLIP-seq
MIRT934935	hsa-miR-4267	CLIP-seq
MIRT934936	hsa-miR-4691-5p	CLIP-seq
MIRT2212116	hsa-miR-2053	CLIP-seq
MIRT2212117	hsa-miR-302f	CLIP-seq
MIRT2212118	hsa-miR-3128	CLIP-seq
MIRT2212119	hsa-miR-3148	CLIP-seq
MIRT2212120	hsa-miR-3157-5p	CLIP-seq
MIRT2212121	hsa-miR-3173-3p	CLIP-seq
MIRT2212122	hsa-miR-4305	CLIP-seq
MIRT2212123	hsa-miR-4422	CLIP-seq
MIRT2212124	hsa-miR-4428	CLIP-seq
MIRT2212125	hsa-miR-4496	CLIP-seq
MIRT2212126	hsa-miR-4521	CLIP-seq
MIRT2212127	hsa-miR-4522	CLIP-seq
MIRT2212128	hsa-miR-4659a-3p	CLIP-seq
MIRT2212129	hsa-miR-4659b-3p	CLIP-seq
MIRT2212130	hsa-miR-4691-3p	CLIP-seq
MIRT2212131	hsa-miR-4720-3p	CLIP-seq
MIRT2212132	hsa-miR-4720-5p	CLIP-seq
MIRT2212133	hsa-miR-4762-5p	CLIP-seq
MIRT2212134	hsa-miR-4771	CLIP-seq
MIRT2212135	hsa-miR-4778-3p	CLIP-seq
MIRT2212136	hsa-miR-4799-3p	CLIP-seq
MIRT2212137	hsa-miR-4804-3p	CLIP-seq
MIRT2212138	hsa-miR-569	CLIP-seq
MIRT2212139	hsa-miR-651	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYB	Unknown	15105423
MYBL1	Unknown	15105423

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IBA
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IDA	16685466
GO:0004090	Function	Carbonyl reductase (NADPH) activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IDA	1847869
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	11997086
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	11944995, 11997086
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	19443906
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0008207	Process	C21-steroid hormone metabolic process	NAS	7556196
GO:0008285	Process	Negative regulation of cell population proliferation	NAS	1847869
GO:0009636	Process	Response to toxic substance	IDA	16685466
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IDA	16685466
GO:0022900	Process	Electron transport chain	IDA	16685466
GO:0034599	Process	Cellular response to oxidative stress	IDA	19443906
GO:0043011	Process	Myeloid dendritic cell differentiation	IEP	11944995
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19443906

Other IDs

• MIM: 615194
• HGNC: 18349
• e!Ensembl: ENSG00000100867

Protein

• UniProt ID: Q13268
• Protein name: Dehydrogenase/reductase SDR family member 2, mitochondrial (EC 1.1.1.-) (Dicarbonyl reductase HEP27) (Protein D) (Short chain dehydrogenase/reductase family 25C member 1) (Protein SDR25C1)
• Protein function: NADPH-dependent oxidoreductase which catalyzes the reduction of dicarbonyl compounds. Displays reductase activity in vitro with 3,4-hexanedione, 2,3-heptanedione and 1-phenyl-1,2-propanedione as substrates (PubMed:16685466). May function as a di
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13561	adh_short_C2	43 → 277		Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, with highest levels in liver and kidney, followed by heart, spleen, skeletal muscle and placenta. In hemopoietic cells, expressed in dendritic cells, but not in monocytes, macrophages, granulocytes, nor in B and T lym
• Sequence:

  MLSAVARGYQGWFHPCARLSVRMSSTGIDRKGVLANRVAVVTGSTSGIGFAIARRLARDG
  AHVVISSRKQQNVDRAMAKLQGEGLSVAGIVCHVGKAEDREQLVAKALEHCGGVDFLVCS
  AGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLLPYMENRRGAVILVSSIAAYNPVV
  ALGVYNVSKTALLGLTRTLALELAPKDIRVNCVVPGIIKTDFSKVFHGNESLWKNFKEHH
  QLQRIGESEDCAGIVSFLCSPDASYVNGENIAVAGYSTRL

• Sequence length: 280

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute otitis media	Otitis media	BEFREE	29395516		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20547751, 36594618	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33667649	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37119764	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31423895		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31447126		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31436301		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31436301	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35401936	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	7556196	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32586085	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20547751		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	27195521		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31423895		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27195521, 30535463		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31291971		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	28151410, 28372533		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31423895		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31423895, 36192391	Inhibit	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	27195521		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29106393, 30535463		★☆☆☆☆ Found in Text Mining only