Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10200
Gene name	M-phase phosphoprotein 6
Gene symbol	MPHOSPH6
Synonyms (NCBI Gene)	MPPMPP-6MPP6
Chromosome	16
Chromosome location	16q23.3

137

Show/Hide all (137)

miRTarBase ID	miRNA	Experiments
MIRT1156019	hsa-miR-101	CLIP-seq
MIRT1156020	hsa-miR-144	CLIP-seq
MIRT1156021	hsa-miR-297	CLIP-seq
MIRT1156022	hsa-miR-3149	CLIP-seq
MIRT1156023	hsa-miR-3192	CLIP-seq
MIRT1156024	hsa-miR-3661	CLIP-seq
MIRT1156025	hsa-miR-369-3p	CLIP-seq
MIRT1156026	hsa-miR-4300	CLIP-seq
MIRT1156027	hsa-miR-4495	CLIP-seq
MIRT1156028	hsa-miR-489	CLIP-seq
MIRT1156029	hsa-miR-548g	CLIP-seq
MIRT1156030	hsa-miR-567	CLIP-seq
MIRT1156031	hsa-miR-582-5p	CLIP-seq
MIRT1156032	hsa-miR-631	CLIP-seq
MIRT1156033	hsa-miR-920	CLIP-seq
MIRT2044596	hsa-miR-146b-3p	CLIP-seq
MIRT2044597	hsa-miR-185	CLIP-seq
MIRT2044598	hsa-miR-194	CLIP-seq
MIRT1156021	hsa-miR-297	CLIP-seq
MIRT2044599	hsa-miR-3135b	CLIP-seq
MIRT1156022	hsa-miR-3149	CLIP-seq
MIRT2044600	hsa-miR-3652	CLIP-seq
MIRT2044601	hsa-miR-4306	CLIP-seq
MIRT2044602	hsa-miR-4430	CLIP-seq
MIRT2044603	hsa-miR-4476	CLIP-seq
MIRT2044604	hsa-miR-4644	CLIP-seq
MIRT1156028	hsa-miR-489	CLIP-seq
MIRT1156030	hsa-miR-567	CLIP-seq
MIRT2044605	hsa-miR-651	CLIP-seq
MIRT2273842	hsa-miR-1244	CLIP-seq
MIRT2273843	hsa-miR-1255a	CLIP-seq
MIRT2273844	hsa-miR-1255b	CLIP-seq
MIRT2273845	hsa-miR-134	CLIP-seq
MIRT2273846	hsa-miR-146a	CLIP-seq
MIRT2044596	hsa-miR-146b-3p	CLIP-seq
MIRT2273847	hsa-miR-146b-5p	CLIP-seq
MIRT2273848	hsa-miR-199a-3p	CLIP-seq
MIRT2273849	hsa-miR-199b-3p	CLIP-seq
MIRT2273850	hsa-miR-224	CLIP-seq
MIRT1156021	hsa-miR-297	CLIP-seq
MIRT2273851	hsa-miR-3118	CLIP-seq
MIRT2273852	hsa-miR-3129-5p	CLIP-seq
MIRT1156022	hsa-miR-3149	CLIP-seq
MIRT1156023	hsa-miR-3192	CLIP-seq
MIRT1156024	hsa-miR-3661	CLIP-seq
MIRT2273853	hsa-miR-3670	CLIP-seq
MIRT1156025	hsa-miR-369-3p	CLIP-seq
MIRT2273854	hsa-miR-380	CLIP-seq
MIRT2273855	hsa-miR-3924	CLIP-seq
MIRT2273856	hsa-miR-3974	CLIP-seq
MIRT2273857	hsa-miR-425	CLIP-seq
MIRT2273858	hsa-miR-4276	CLIP-seq
MIRT1156026	hsa-miR-4300	CLIP-seq
MIRT2273859	hsa-miR-4434	CLIP-seq
MIRT2273860	hsa-miR-4477a	CLIP-seq
MIRT1156027	hsa-miR-4495	CLIP-seq
MIRT2273861	hsa-miR-450b-3p	CLIP-seq
MIRT2273862	hsa-miR-4516	CLIP-seq
MIRT2273863	hsa-miR-4531	CLIP-seq
MIRT2273864	hsa-miR-4668-3p	CLIP-seq
MIRT2273865	hsa-miR-4697-3p	CLIP-seq
MIRT2273866	hsa-miR-4761-5p	CLIP-seq
MIRT1156028	hsa-miR-489	CLIP-seq
MIRT2273867	hsa-miR-556-5p	CLIP-seq
MIRT1156030	hsa-miR-567	CLIP-seq
MIRT1156032	hsa-miR-631	CLIP-seq
MIRT2273868	hsa-miR-656	CLIP-seq
MIRT2273869	hsa-miR-769-3p	CLIP-seq
MIRT1156033	hsa-miR-920	CLIP-seq
MIRT2572742	hsa-miR-124	CLIP-seq
MIRT2044597	hsa-miR-185	CLIP-seq
MIRT1156021	hsa-miR-297	CLIP-seq
MIRT2044599	hsa-miR-3135b	CLIP-seq
MIRT1156022	hsa-miR-3149	CLIP-seq
MIRT2572743	hsa-miR-3161	CLIP-seq
MIRT1156023	hsa-miR-3192	CLIP-seq
MIRT2572744	hsa-miR-331-3p	CLIP-seq
MIRT2044600	hsa-miR-3652	CLIP-seq
MIRT1156024	hsa-miR-3661	CLIP-seq
MIRT1156025	hsa-miR-369-3p	CLIP-seq
MIRT2572745	hsa-miR-3714	CLIP-seq
MIRT2572746	hsa-miR-374a	CLIP-seq
MIRT2572747	hsa-miR-374b	CLIP-seq
MIRT2572748	hsa-miR-3910	CLIP-seq
MIRT2572749	hsa-miR-410	CLIP-seq
MIRT2572750	hsa-miR-4292	CLIP-seq
MIRT1156026	hsa-miR-4300	CLIP-seq
MIRT2044601	hsa-miR-4306	CLIP-seq
MIRT2044602	hsa-miR-4430	CLIP-seq
MIRT1156027	hsa-miR-4495	CLIP-seq
MIRT2572751	hsa-miR-4529-5p	CLIP-seq
MIRT2572752	hsa-miR-4640-5p	CLIP-seq
MIRT2044604	hsa-miR-4644	CLIP-seq
MIRT2572753	hsa-miR-4720-3p	CLIP-seq
MIRT2572754	hsa-miR-4726-5p	CLIP-seq
MIRT2572755	hsa-miR-4803	CLIP-seq
MIRT1156028	hsa-miR-489	CLIP-seq
MIRT2572756	hsa-miR-506	CLIP-seq
MIRT2572757	hsa-miR-513a-3p	CLIP-seq
MIRT2572758	hsa-miR-526b	CLIP-seq
MIRT1156030	hsa-miR-567	CLIP-seq
MIRT1156032	hsa-miR-631	CLIP-seq
MIRT1156033	hsa-miR-920	CLIP-seq
MIRT2572742	hsa-miR-124	CLIP-seq
MIRT2044597	hsa-miR-185	CLIP-seq
MIRT1156021	hsa-miR-297	CLIP-seq
MIRT2044599	hsa-miR-3135b	CLIP-seq
MIRT1156022	hsa-miR-3149	CLIP-seq
MIRT2572743	hsa-miR-3161	CLIP-seq
MIRT1156023	hsa-miR-3192	CLIP-seq
MIRT2572744	hsa-miR-331-3p	CLIP-seq
MIRT2044600	hsa-miR-3652	CLIP-seq
MIRT1156024	hsa-miR-3661	CLIP-seq
MIRT1156025	hsa-miR-369-3p	CLIP-seq
MIRT2572745	hsa-miR-3714	CLIP-seq
MIRT2572746	hsa-miR-374a	CLIP-seq
MIRT2572747	hsa-miR-374b	CLIP-seq
MIRT2572748	hsa-miR-3910	CLIP-seq
MIRT2572749	hsa-miR-410	CLIP-seq
MIRT2572750	hsa-miR-4292	CLIP-seq
MIRT1156026	hsa-miR-4300	CLIP-seq
MIRT2044601	hsa-miR-4306	CLIP-seq
MIRT2044602	hsa-miR-4430	CLIP-seq
MIRT1156027	hsa-miR-4495	CLIP-seq
MIRT2572751	hsa-miR-4529-5p	CLIP-seq
MIRT2572752	hsa-miR-4640-5p	CLIP-seq
MIRT2044604	hsa-miR-4644	CLIP-seq
MIRT2572753	hsa-miR-4720-3p	CLIP-seq
MIRT2572754	hsa-miR-4726-5p	CLIP-seq
MIRT2572755	hsa-miR-4803	CLIP-seq
MIRT1156028	hsa-miR-489	CLIP-seq
MIRT2572756	hsa-miR-506	CLIP-seq
MIRT2572757	hsa-miR-513a-3p	CLIP-seq
MIRT2572758	hsa-miR-526b	CLIP-seq
MIRT1156030	hsa-miR-567	CLIP-seq
MIRT1156032	hsa-miR-631	CLIP-seq
MIRT1156033	hsa-miR-920	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000176	Component	Nuclear exosome (RNase complex)	IDA	26166824
GO:0000176	Component	Nuclear exosome (RNase complex)	TAS	11719186
GO:0000178	Component	Exosome (RNase complex)	IDA	11719186, 20531389
GO:0000460	Process	Maturation of 5.8S rRNA	IBA
GO:0000460	Process	Maturation of 5.8S rRNA	IMP	17412707
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	11719186, 15231747, 16396833, 17412707, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	8885239
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006364	Process	RRNA processing	IEA

MIM	HGNC	e!Ensembl
605500	7214	ENSG00000135698

Q99547

Protein name

M-phase phosphoprotein 6

Protein function

RNA-binding protein that associates with the RNA exosome complex. Involved in the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and play a role in recruiting the RNA exosome complex to pre-rRNA; this function may include C1D. {ECO:0000

PDB

6D6Q , 6D6R , 6H25

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10175	MPP6	7 → 135	M-phase phosphoprotein 6	Family

Sequence

MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIE
EQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYET
LVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD

Sequence length

160

Interactions

View interactions

	KEGG		Reactome
	RNA degradation		Major pathway of rRNA processing in the nucleolus and cytosol

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carnevale syndrome	Carnevale syndrome	Pubtator	27023472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29100383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29100383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29100383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Testotoxicosis	Testotoxicosis	BEFREE	9777570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28985021, 30145731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37079368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	19502386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24516257, 29293312, 30126367, 31704599, 9777570		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28922532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10799759, 12710931, 18262354, 19883732, 19962414, 24412329, 26979073, 28445933, 28849030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27023472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10972966, 12710931, 16460685, 18262354, 18495557, 19369384, 19962414, 20060621, 21856379, 24055409, 24217228, 24412329, 24989254, 25232110, 26979073 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	17077307, 19369384, 19857570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	28117656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	20727424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	19369384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34323415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MPHOSPH6 (M-phase phosphoprotein 6)