Gene Gene information from NCBI Gene database.
Entrez ID 101929726
Gene name Myomixer, myoblast fusion factor
Gene symbol MYMX
Synonyms (NCBI Gene)
CFZS2MINIONhMINION
Chromosome 6
Chromosome location 6p21.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IBA
GO:0000139 Component Golgi membrane IEA
GO:0005789 Component Endoplasmic reticulum membrane IBA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619912 52391 ENSG00000262179
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1B0GTQ4
Protein name Protein myomixer (Microprotein inducer of fusion) (Protein minion) (hMINION)
Protein function Myoblast-specific protein that mediates myoblast fusion, an essential step for the formation of multi-nucleated muscle fibers (PubMed:28569745, PubMed:35642635). Involved in membrane fusion downstream of the lipid mixing step mediated by MYMK (B
Family and domains
Sequence
MPTPLLPLLLRLLLSCLLLPAARLARQYLLPLLRRLARRLGSQDMREALLGCLLFILSQR
HSPDAGEASRVDRLERRERLGPQK
Sequence length 84
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Carey-Fineman-Ziter syndrome 2 Pathogenic rs1370240821 RCV002260936
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CAREY-FINEMAN-ZITER SYNDROME Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Carcinoma Colorectal Cancer BEFREE 29976644
★☆☆☆☆
Found in Text Mining only
Hairy Cell Leukemia Hairy Cell Leukemia BEFREE 29238890
★☆☆☆☆
Found in Text Mining only
Hairy cell leukemia variant Hairy Cell Leukemia BEFREE 29238890
★☆☆☆☆
Found in Text Mining only
Hemorrhage Hemorrhage Pubtator 29851527 Associate
★☆☆☆☆
Found in Text Mining only
Myelocerebellar Disorder Myelocerebellar Disorder BEFREE 31015479
★☆☆☆☆
Found in Text Mining only
Myeloid Leukemia, Chronic Myeloid Leukemia BEFREE 29541390
★☆☆☆☆
Found in Text Mining only
Periodontitis Periodontitis BEFREE 29976644
★☆☆☆☆
Found in Text Mining only