TXNDC9 (thioredoxin domain containing 9)

Gene

• Entrez ID: 10190
• Gene name: Thioredoxin domain containing 9
• Gene symbol: TXNDC9
• Synonyms (NCBI Gene): APACD, PHLP3
• Chromosome: 2
• Chromosome location: 2q11.2
• Summary: The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1465242	hsa-miR-300	CLIP-seq
MIRT1465243	hsa-miR-381	CLIP-seq
MIRT2360552	hsa-miR-3160-5p	CLIP-seq
MIRT2360553	hsa-miR-4642	CLIP-seq
MIRT2360554	hsa-miR-4698	CLIP-seq
MIRT2360555	hsa-miR-4711-5p	CLIP-seq
MIRT2360556	hsa-miR-4719	CLIP-seq
MIRT2360557	hsa-miR-4720-5p	CLIP-seq
MIRT2360558	hsa-miR-4799-3p	CLIP-seq
MIRT2360559	hsa-miR-513b	CLIP-seq
MIRT2360560	hsa-miR-544	CLIP-seq
MIRT2360561	hsa-miR-567	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0005515	Function	Protein binding	IPI	16169070, 21516116, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0030496	Component	Midbody	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996

Other IDs

• MIM: 612564
• HGNC: 24110
• e!Ensembl: ENSG00000115514

Protein

• UniProt ID: O14530
• Protein name: Thioredoxin domain-containing protein 9 (ATP-binding protein associated with cell differentiation) (Protein 1-4)
• Protein function: Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00085	Thioredoxin	75 → 172	Thioredoxin	Domain

• Sequence:

  MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQ
  QKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLE
  TKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLG
  SSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD

• Sequence length: 226

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30382079	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37303736	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23210642		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30382079		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35485284	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASDB_DG	22472876		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31477836		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23210642		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23210642, 31477836		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31477836		★☆☆☆☆ Found in Text Mining only