Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10188
Gene name	Tyrosine kinase non receptor 2
Gene symbol	TNK2
Synonyms (NCBI Gene)	ACKACK-1ACK1p21cdc42Hs
Chromosome	3
Chromosome location	3q29
Summary	This gene encodes a tyrosine kinase that binds Cdc42Hs in its GTP-bound form and inhibits both the intrinsic and GTPase-activating protein (GAP)-stimulated GTPase activity of Cdc42Hs. This binding is mediated by a unique sequence of 47 amino acids C-termi

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs112384084	C>T	Benign, likely-pathogenic	Missense variant, coding sequence variant

117

Show/Hide all (117)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041931	hsa-miR-484	CLASH	23622248
MIRT508920	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT508919	hsa-miR-4779	PAR-CLIP	23446348
MIRT508918	hsa-miR-181d-3p	PAR-CLIP	23446348
MIRT508916	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT508915	hsa-miR-4433a-5p	PAR-CLIP	23446348
MIRT508913	hsa-miR-4266	PAR-CLIP	23446348
MIRT508914	hsa-miR-1260a	PAR-CLIP	23446348
MIRT508912	hsa-miR-1260b	PAR-CLIP	23446348
MIRT508911	hsa-miR-5571-3p	PAR-CLIP	23446348
MIRT508920	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT508919	hsa-miR-4779	PAR-CLIP	23446348
MIRT508918	hsa-miR-181d-3p	PAR-CLIP	23446348
MIRT508917	hsa-miR-1910-5p	PAR-CLIP	23446348
MIRT508916	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT508915	hsa-miR-4433a-5p	PAR-CLIP	23446348
MIRT508913	hsa-miR-4266	PAR-CLIP	23446348
MIRT508914	hsa-miR-1260a	PAR-CLIP	23446348
MIRT508912	hsa-miR-1260b	PAR-CLIP	23446348
MIRT508911	hsa-miR-5571-3p	PAR-CLIP	23446348
MIRT508916	hsa-miR-1224-3p	PAR-CLIP	26701625
MIRT508916	hsa-miR-1224-3p	PAR-CLIP	26701625
MIRT508916	hsa-miR-1224-3p	PAR-CLIP	26701625
MIRT508914	hsa-miR-1260a	PAR-CLIP	26701625
MIRT508914	hsa-miR-1260a	PAR-CLIP	26701625
MIRT508914	hsa-miR-1260a	PAR-CLIP	26701625
MIRT508912	hsa-miR-1260b	PAR-CLIP	26701625
MIRT508912	hsa-miR-1260b	PAR-CLIP	26701625
MIRT508912	hsa-miR-1260b	PAR-CLIP	26701625
MIRT508918	hsa-miR-181d-3p	PAR-CLIP	26701625
MIRT508918	hsa-miR-181d-3p	PAR-CLIP	26701625
MIRT508918	hsa-miR-181d-3p	PAR-CLIP	26701625
MIRT508913	hsa-miR-4266	PAR-CLIP	26701625
MIRT508913	hsa-miR-4266	PAR-CLIP	26701625
MIRT508913	hsa-miR-4266	PAR-CLIP	26701625
MIRT508915	hsa-miR-4433a-5p	PAR-CLIP	26701625
MIRT508915	hsa-miR-4433a-5p	PAR-CLIP	26701625
MIRT508915	hsa-miR-4433a-5p	PAR-CLIP	26701625
MIRT508920	hsa-miR-4695-5p	PAR-CLIP	26701625
MIRT508920	hsa-miR-4695-5p	PAR-CLIP	26701625
MIRT508920	hsa-miR-4695-5p	PAR-CLIP	26701625
MIRT508919	hsa-miR-4779	PAR-CLIP	26701625
MIRT508919	hsa-miR-4779	PAR-CLIP	26701625
MIRT508919	hsa-miR-4779	PAR-CLIP	26701625
MIRT508911	hsa-miR-5571-3p	PAR-CLIP	26701625
MIRT508911	hsa-miR-5571-3p	PAR-CLIP	26701625
MIRT508911	hsa-miR-5571-3p	PAR-CLIP	26701625
MIRT508920	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT508919	hsa-miR-4779	PAR-CLIP	23446348
MIRT508918	hsa-miR-181d-3p	PAR-CLIP	23446348
MIRT508916	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT508915	hsa-miR-4433a-5p	PAR-CLIP	23446348
MIRT508913	hsa-miR-4266	PAR-CLIP	23446348
MIRT508914	hsa-miR-1260a	PAR-CLIP	23446348
MIRT508912	hsa-miR-1260b	PAR-CLIP	23446348
MIRT508911	hsa-miR-5571-3p	PAR-CLIP	23446348
MIRT508920	hsa-miR-4695-5p	PAR-CLIP	23446348
MIRT508919	hsa-miR-4779	PAR-CLIP	23446348
MIRT508918	hsa-miR-181d-3p	PAR-CLIP	23446348
MIRT508917	hsa-miR-1910-5p	PAR-CLIP	23446348
MIRT508916	hsa-miR-1224-3p	PAR-CLIP	23446348
MIRT508915	hsa-miR-4433a-5p	PAR-CLIP	23446348
MIRT508913	hsa-miR-4266	PAR-CLIP	23446348
MIRT508914	hsa-miR-1260a	PAR-CLIP	23446348
MIRT508912	hsa-miR-1260b	PAR-CLIP	23446348
MIRT508911	hsa-miR-5571-3p	PAR-CLIP	23446348
MIRT1443699	hsa-miR-1203	CLIP-seq
MIRT1443700	hsa-miR-1260	CLIP-seq
MIRT1443701	hsa-miR-1280	CLIP-seq
MIRT1443702	hsa-miR-1297	CLIP-seq
MIRT1443703	hsa-miR-1299	CLIP-seq
MIRT1443704	hsa-miR-15a	CLIP-seq
MIRT1443705	hsa-miR-15b	CLIP-seq
MIRT1443706	hsa-miR-16	CLIP-seq
MIRT1443707	hsa-miR-1827	CLIP-seq
MIRT1443708	hsa-miR-1913	CLIP-seq
MIRT1443709	hsa-miR-195	CLIP-seq
MIRT1443710	hsa-miR-224	CLIP-seq
MIRT1443711	hsa-miR-23a	CLIP-seq
MIRT1443712	hsa-miR-23b	CLIP-seq
MIRT1443713	hsa-miR-23c	CLIP-seq
MIRT1443714	hsa-miR-26a	CLIP-seq
MIRT1443715	hsa-miR-26b	CLIP-seq
MIRT1443716	hsa-miR-3185	CLIP-seq
MIRT1443717	hsa-miR-324-3p	CLIP-seq
MIRT1443718	hsa-miR-326	CLIP-seq
MIRT1443719	hsa-miR-330-5p	CLIP-seq
MIRT1443720	hsa-miR-3918	CLIP-seq
MIRT1443721	hsa-miR-424	CLIP-seq
MIRT1443722	hsa-miR-4438	CLIP-seq
MIRT1443723	hsa-miR-4465	CLIP-seq
MIRT1443724	hsa-miR-4640-5p	CLIP-seq
MIRT1443725	hsa-miR-4685-5p	CLIP-seq
MIRT1443726	hsa-miR-4717-5p	CLIP-seq
MIRT1443727	hsa-miR-4724-5p	CLIP-seq
MIRT1443728	hsa-miR-4726-5p	CLIP-seq
MIRT1443729	hsa-miR-4727-5p	CLIP-seq
MIRT1443730	hsa-miR-4736	CLIP-seq
MIRT1443731	hsa-miR-4753-5p	CLIP-seq
MIRT1443732	hsa-miR-497	CLIP-seq
MIRT1443733	hsa-miR-7	CLIP-seq
MIRT1443734	hsa-miR-875-3p	CLIP-seq
MIRT1443735	hsa-miR-891b	CLIP-seq
MIRT1443736	hsa-miR-940	CLIP-seq
MIRT2132775	hsa-miR-2964a-5p	CLIP-seq
MIRT2132776	hsa-miR-3155	CLIP-seq
MIRT2132777	hsa-miR-3155b	CLIP-seq
MIRT1443716	hsa-miR-3185	CLIP-seq
MIRT2132778	hsa-miR-4269	CLIP-seq
MIRT2132779	hsa-miR-4645-5p	CLIP-seq
MIRT2132780	hsa-miR-4673	CLIP-seq
MIRT1443725	hsa-miR-4685-5p	CLIP-seq
MIRT2132781	hsa-miR-4691-5p	CLIP-seq
MIRT1443733	hsa-miR-7	CLIP-seq
MIRT2132782	hsa-miR-4722-5p	CLIP-seq
MIRT1443716	hsa-miR-3185	CLIP-seq
MIRT1443733	hsa-miR-7	CLIP-seq

Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IDA	16257963
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	18993068
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	8497321
GO:0005095	Function	GTPase inhibitor activity	TAS	8497321
GO:0005154	Function	Epidermal growth factor receptor binding	IDA	20086093
GO:0005515	Function	Protein binding	IPI	10360579, 10587647, 11157984, 17038317, 19798056, 20333297, 20936779, 22939624, 23686771, 25416956, 25910212, 26496610, 31980649, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	20333297
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	20979614
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005768	Component	Endosome	ISS
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	20333297, 20979614
GO:0005886	Component	Plasma membrane	IEA
GO:0005905	Component	Clathrin-coated pit	IDA	21169560
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005912	Component	Adherens junction	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	20432460
GO:0007264	Process	Small GTPase-mediated signal transduction	TAS	8497321
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016310	Process	Phosphorylation	IDA	20333297, 20979614
GO:0016740	Function	Transferase activity	IEA
GO:0030136	Component	Clathrin-coated vesicle	IDA	18262180
GO:0030136	Component	Clathrin-coated vesicle	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	23686771
GO:0042802	Function	Identical protein binding	IPI	16472662, 25416956
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050699	Function	WW domain binding	ISS
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	10587647
GO:0070161	Component	Anchoring junction	IEA
GO:0070436	Component	Grb2-EGFR complex	IDA	20086093
GO:0097268	Component	Cytoophidium	IDA	25223282
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2000369	Process	Regulation of clathrin-dependent endocytosis	IDA	18262180

MIM	HGNC	e!Ensembl
606994	19297	ENSG00000061938

Q07912

Protein name

Activated CDC42 kinase 1 (ACK-1) (EC 2.7.10.2) (EC 2.7.11.1) (Tyrosine kinase non-receptor protein 2)

Protein function

Non-receptor tyrosine-protein and serine/threonine-protein kinase that is implicated in cell spreading and migration, cell survival, cell growth and proliferation. Transduces extracellular signals to cytosolic and nuclear effectors. Phosphorylat

PDB

1CF4 , 1U46 , 1U4D , 1U54 , 3EQP , 3EQR , 4EWH , 4HZR , 4HZS , 4ID7 , 5ZXB , 6VQM , 7KP6 , 8FE9 , 8FZ3 , 8HMT , 8Q5P , 8THA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07714	PK_Tyr_Ser-Thr	126 → 385	Protein tyrosine and serine/threonine kinase	Domain
PF14604	SH3_9	395 → 444	Variant SH3 domain	Domain
PF09027	GTPase_binding	449 → 514	GTPase binding	Domain
PF11555	Inhibitor_Mig-6	774 → 840	EGFR receptor inhibitor Mig-6	Family

Tissue specificity

TISSUE SPECIFICITY: The Tyr-284 phosphorylated form shows a significant increase in expression in breast cancers during the progressive stages i.e. normal to hyperplasia (ADH), ductal carcinoma in situ (DCIS), invasive ductal carcinoma (IDC) and lymph nod

Sequence

MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCL
IGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNA
MHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGM
GYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPE
SLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDI
YNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPD
RIDELYLGNPMDPPDLLSVELSTSRPPQHLGGVKKPTYDPVSEDQDPLSSDFKRLGLRKP
GLPRGLWLAKPSARVPGTKASRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLL
DETPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEICSINSTLVGAGVP
AGPSQGQTNYAFVPEQARPPPPLEDNLFLPPQGGGKPPSSAQTAEIFQALQQECMRQLQA
PAGSPAPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWPGPASPPRVPP
REPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRA
GPCILPIVRDGKKVSSTHYYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLLLPPPSTP
APAAPTATVRPMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPAD
KIQMAMVHGVTTEECQAALQCHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNL
EQAGCHLLGSWGPAHHKR

Sequence length

1038

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Epileptic encephalopathy	Pathogenic	rs1418694748	RCV001813922	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Abnormality of neuronal migration	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal recessive infantile epilepsy	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental and epileptic encephalopathy	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Familial cancer of breast	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC GENERALIZED EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Infantile epilepsy	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson disease	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Sarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TNK2-associated Epilepsy syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TNK2-related disorder	Uncertain significance; Benign; Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (68)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24461128, 28739485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	26621748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18435854, 27902967, 31751910, 31772931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18435854, 23208506, 26635363, 37330596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25257795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33213062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20359967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27926694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	27926694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30036625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27926694, 35057760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	27926694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25427824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	25427824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioid carcinoma ovary	Ovarian endometrioid carcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	GENOMICS_ENGLAND_DG	23686771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	23686771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	23686771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33484472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ethylmalonic encephalopathy	Ethylmalonic Encephalopathy	GENOMICS_ENGLAND_DG	23686771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	36921738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25257795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25257795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25257795, 35862252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile-onset mesial temporal lobe epilepsy with severe cognitive regression	Mesial Temporal Lobe Epilepsy With Cognitive Regression	ORPHANET_DG	23686771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile-onset mesial temporal lobe epilepsy with severe cognitive regression	Mesial Temporal Lobe Epilepsy With Cognitive Regression	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27926694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	30018082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	20359967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27576506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30018082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26635363, 27576506, 35941836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25445114, 26536663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	19233941		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	33495411	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26005050, 36854171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37847650	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	18435854, 27902967, 31751910, 31772931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25427824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	19233941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26498357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17494760, 20383201, 20623637, 25950519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17109515, 24178904, 26498357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16247015, 18435854, 20110370, 20359967, 23597703, 31845724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18435854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10587647	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	22147262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16247015, 17494760, 18435854, 20359967, 20383201, 23597703, 24461128, 25950519, 27902967, 27926694, 29386546, 31772931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	21156648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24461128, 25945695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28189676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37196681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22322295, 33213062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26595808	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Parkinson Disease	Parkinson disease	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Prostate carcinoma	Prostate cancer	BEFREE	17494760, 20383201, 20623637, 25950519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17494760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25950519, 28609657, 35849143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	20718987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	30036625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17109515, 24178904, 26498357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17109515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17109515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27902967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27926694		★★★★★ ★☆☆☆☆ Found in Text Mining only

TNK2 (tyrosine kinase non receptor 2)