Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10181
Gene name	RNA binding motif protein 5
Gene symbol	RBM5
Synonyms (NCBI Gene)	G15H37LUCA-15LUCA15RMB5
Chromosome	3
Chromosome location	3p21.31
Summary	This gene is a candidate tumor suppressor gene which encodes a nuclear RNA binding protein that is a component of the spliceosome A complex. The encoded protein plays a role in the induction of cell cycle arrest and apoptosis through pre-mRNA splicing of

138

Show/Hide all (138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028583	hsa-miR-30a-5p	Proteomics	18668040
MIRT050882	hsa-miR-17-5p	CLASH	23622248
MIRT050746	hsa-miR-17-3p	CLASH	23622248
MIRT045057	hsa-miR-186-5p	CLASH	23622248
MIRT036197	hsa-miR-320b	CLASH	23622248
MIRT626110	hsa-miR-4448	HITS-CLIP	23824327
MIRT626110	hsa-miR-4448	HITS-CLIP	23824327
MIRT439799	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439799	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT736795	hsa-miR-938	Luciferase reporter assayWestern blottingFlow cytometry	31498514
MIRT626110	hsa-miR-4448	HITS-CLIP	23824327
MIRT626110	hsa-miR-4448	HITS-CLIP	23824327
MIRT2088142	hsa-miR-3065-5p	CLIP-seq
MIRT2088143	hsa-miR-3617	CLIP-seq
MIRT2088144	hsa-miR-3913-3p	CLIP-seq
MIRT2088145	hsa-miR-4457	CLIP-seq
MIRT2088146	hsa-miR-499-3p	CLIP-seq
MIRT2088147	hsa-miR-499a-3p	CLIP-seq
MIRT2088148	hsa-miR-641	CLIP-seq
MIRT2313026	hsa-miR-1226	CLIP-seq
MIRT2313027	hsa-miR-1252	CLIP-seq
MIRT2313028	hsa-miR-1294	CLIP-seq
MIRT2313029	hsa-miR-197	CLIP-seq
MIRT2313030	hsa-miR-3134	CLIP-seq
MIRT2313031	hsa-miR-3184	CLIP-seq
MIRT2313032	hsa-miR-3619-3p	CLIP-seq
MIRT2313033	hsa-miR-3686	CLIP-seq
MIRT2313034	hsa-miR-423-5p	CLIP-seq
MIRT2313035	hsa-miR-4316	CLIP-seq
MIRT2313036	hsa-miR-4476	CLIP-seq
MIRT2313037	hsa-miR-4493	CLIP-seq
MIRT2313038	hsa-miR-4533	CLIP-seq
MIRT2313039	hsa-miR-4534	CLIP-seq
MIRT2313040	hsa-miR-4645-5p	CLIP-seq
MIRT2313041	hsa-miR-4656	CLIP-seq
MIRT2313042	hsa-miR-4673	CLIP-seq
MIRT2313043	hsa-miR-4733-3p	CLIP-seq
MIRT2313044	hsa-miR-4742-5p	CLIP-seq
MIRT2313045	hsa-miR-4747-5p	CLIP-seq
MIRT2313046	hsa-miR-4753-5p	CLIP-seq
MIRT2313047	hsa-miR-4776-5p	CLIP-seq
MIRT2313048	hsa-miR-4778-5p	CLIP-seq
MIRT2609245	hsa-miR-1	CLIP-seq
MIRT2313028	hsa-miR-1294	CLIP-seq
MIRT2609246	hsa-miR-1908	CLIP-seq
MIRT2609247	hsa-miR-2054	CLIP-seq
MIRT2609248	hsa-miR-206	CLIP-seq
MIRT2609249	hsa-miR-300	CLIP-seq
MIRT2088142	hsa-miR-3065-5p	CLIP-seq
MIRT2609250	hsa-miR-3119	CLIP-seq
MIRT2609251	hsa-miR-3120-3p	CLIP-seq
MIRT2313030	hsa-miR-3134	CLIP-seq
MIRT2609252	hsa-miR-3140-3p	CLIP-seq
MIRT2609253	hsa-miR-3183	CLIP-seq
MIRT2313031	hsa-miR-3184	CLIP-seq
MIRT2088143	hsa-miR-3617	CLIP-seq
MIRT2313032	hsa-miR-3619-3p	CLIP-seq
MIRT2609254	hsa-miR-3647-3p	CLIP-seq
MIRT2313033	hsa-miR-3686	CLIP-seq
MIRT2609255	hsa-miR-371-5p	CLIP-seq
MIRT2609256	hsa-miR-371b-5p	CLIP-seq
MIRT2609257	hsa-miR-381	CLIP-seq
MIRT2609258	hsa-miR-3909	CLIP-seq
MIRT2088144	hsa-miR-3913-3p	CLIP-seq
MIRT2313034	hsa-miR-423-5p	CLIP-seq
MIRT2609259	hsa-miR-4257	CLIP-seq
MIRT2313035	hsa-miR-4316	CLIP-seq
MIRT2088145	hsa-miR-4457	CLIP-seq
MIRT2609260	hsa-miR-4480	CLIP-seq
MIRT2313039	hsa-miR-4534	CLIP-seq
MIRT2313041	hsa-miR-4656	CLIP-seq
MIRT2609261	hsa-miR-4666-3p	CLIP-seq
MIRT2609262	hsa-miR-4687-5p	CLIP-seq
MIRT2609263	hsa-miR-4704-5p	CLIP-seq
MIRT2609264	hsa-miR-4723-3p	CLIP-seq
MIRT2609265	hsa-miR-4731-3p	CLIP-seq
MIRT2609266	hsa-miR-4776-3p	CLIP-seq
MIRT2313047	hsa-miR-4776-5p	CLIP-seq
MIRT2313048	hsa-miR-4778-5p	CLIP-seq
MIRT2609267	hsa-miR-4789-5p	CLIP-seq
MIRT2609268	hsa-miR-4801	CLIP-seq
MIRT2088146	hsa-miR-499-3p	CLIP-seq
MIRT2088147	hsa-miR-499a-3p	CLIP-seq
MIRT2609269	hsa-miR-513b	CLIP-seq
MIRT2609270	hsa-miR-597	CLIP-seq
MIRT2609271	hsa-miR-613	CLIP-seq
MIRT2088148	hsa-miR-641	CLIP-seq
MIRT2609272	hsa-miR-663	CLIP-seq
MIRT2609273	hsa-miR-9	CLIP-seq
MIRT2313026	hsa-miR-1226	CLIP-seq
MIRT2313027	hsa-miR-1252	CLIP-seq
MIRT2609246	hsa-miR-1908	CLIP-seq
MIRT2313029	hsa-miR-197	CLIP-seq
MIRT2609247	hsa-miR-2054	CLIP-seq
MIRT2689465	hsa-miR-221	CLIP-seq
MIRT2689466	hsa-miR-222	CLIP-seq
MIRT2609249	hsa-miR-300	CLIP-seq
MIRT2088142	hsa-miR-3065-5p	CLIP-seq
MIRT2609250	hsa-miR-3119	CLIP-seq
MIRT2609251	hsa-miR-3120-3p	CLIP-seq
MIRT2609252	hsa-miR-3140-3p	CLIP-seq
MIRT2609253	hsa-miR-3183	CLIP-seq
MIRT2689467	hsa-miR-323-3p	CLIP-seq
MIRT2088143	hsa-miR-3617	CLIP-seq
MIRT2609254	hsa-miR-3647-3p	CLIP-seq
MIRT2313033	hsa-miR-3686	CLIP-seq
MIRT2609257	hsa-miR-381	CLIP-seq
MIRT2609258	hsa-miR-3909	CLIP-seq
MIRT2088144	hsa-miR-3913-3p	CLIP-seq
MIRT2689468	hsa-miR-3936	CLIP-seq
MIRT2609259	hsa-miR-4257	CLIP-seq
MIRT2088145	hsa-miR-4457	CLIP-seq
MIRT2313036	hsa-miR-4476	CLIP-seq
MIRT2609260	hsa-miR-4480	CLIP-seq
MIRT2313037	hsa-miR-4493	CLIP-seq
MIRT2313038	hsa-miR-4533	CLIP-seq
MIRT2313040	hsa-miR-4645-5p	CLIP-seq
MIRT2609261	hsa-miR-4666-3p	CLIP-seq
MIRT2313042	hsa-miR-4673	CLIP-seq
MIRT2609262	hsa-miR-4687-5p	CLIP-seq
MIRT2609263	hsa-miR-4704-5p	CLIP-seq
MIRT2609264	hsa-miR-4723-3p	CLIP-seq
MIRT2609265	hsa-miR-4731-3p	CLIP-seq
MIRT2313043	hsa-miR-4733-3p	CLIP-seq
MIRT2313044	hsa-miR-4742-5p	CLIP-seq
MIRT2313045	hsa-miR-4747-5p	CLIP-seq
MIRT2313046	hsa-miR-4753-5p	CLIP-seq
MIRT2609266	hsa-miR-4776-3p	CLIP-seq
MIRT2313048	hsa-miR-4778-5p	CLIP-seq
MIRT2609267	hsa-miR-4789-5p	CLIP-seq
MIRT2609268	hsa-miR-4801	CLIP-seq
MIRT2088146	hsa-miR-499-3p	CLIP-seq
MIRT2088147	hsa-miR-499a-3p	CLIP-seq
MIRT2609269	hsa-miR-513b	CLIP-seq
MIRT2609270	hsa-miR-597	CLIP-seq
MIRT2088148	hsa-miR-641	CLIP-seq
MIRT2609272	hsa-miR-663	CLIP-seq
MIRT2609273	hsa-miR-9	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000245	Process	Spliceosomal complex assembly	IDA	18951082
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IDA	18840686, 18951082
GO:0000398	Process	MRNA splicing, via spliceosome	IBA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	TAS	10352938
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	10352938
GO:0003729	Function	MRNA binding	IDA	18840686
GO:0005515	Function	Protein binding	IPI	18951082, 22365833, 22569250, 24304693, 26871637, 32296183, 32814053, 39251607
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18951082
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10352938
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005681	Component	Spliceosomal complex	TAS	18951082
GO:0005829	Component	Cytosol	IDA
GO:0006396	Process	RNA processing	TAS	10352938
GO:0006397	Process	MRNA processing	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	18951082
GO:0008380	Process	RNA splicing	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	18840686
GO:0043065	Process	Positive regulation of apoptotic process	TAS	18951082
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
606884	9902	ENSG00000003756

P52756

Protein name

RNA-binding protein 5 (Protein G15) (Putative tumor suppressor LUCA15) (RNA-binding motif protein 5) (Renal carcinoma antigen NY-REN-9)

Protein function

Component of the spliceosome A complex. Binds to ssRNA containing the consensus sequence 5'-AGGUAA-3' (PubMed:21256132). Regulates alternative splicing of a number of mRNAs. May modulate splice site pairing after recruitment of the U1 and U2 snR

PDB

2LK0 , 2LK1 , 2LKZ , 5MF9 , 5MFY , 7PCV , 7PDV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	100 → 171	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00641	zf-RanBP	181 → 210	Zn-finger in Ran binding protein and others	Domain
PF17780	OCRE	458 → 509	OCRE domain	Domain
PF01585	G-patch	743 → 787	G-patch domain	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 5 is widely expressed in normal tissues and is expressed at increased levels in T-leukemic cell lines.

Sequence

MGSDKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDDRRGDRYDDYRDYDSP
ERERERRNSDRSEDGYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMES
FEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRP
KFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYYCDTIILRNIAP
HTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP
LKIDGKTIGVDFAKSARKDLVLSDGNRVSAFSVASTAIAAAQWSSTQSQSGEGGSVDYSY
LQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTS
NPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYYDPTTGLYY
DPNSQYYYNSLTQQYLYWDGEKETYVPAAESSSHQQSGLPPAKEGKEKKEKPKSKTAQQI
AKDMERWAKSLNKQKENFKNSFQPVNSLREEERRESAAADAGFALFEKKGALAERQQLIP
ELVRNGDEENPLKRGLVAAYSGDSDNEEELVERLESEEEKLADWKKMACLLCRRQFPNKD
ALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEP
KRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLK
GAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME

Sequence length

815

Interactions

View interactions

	Reactome
			mRNA Splicing - Major Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Male infertility with azoospermia or oligozoospermia due to single gene mutation	Likely pathogenic	rs201956265	RCV003991625	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (48)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	29176597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22866867, 22882865, 23721095, 25441176, 26923134, 31498514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	23935508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31318608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15338470, 17131366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18851835	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31298322	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31318608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10352938, 20186023, 20338664, 22866867, 24332178, 25441176, 26923134, 29176597, 29199590, 30675268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17606309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30964162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30964162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	11029660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28061901	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22162216	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	35013161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	38216972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	38216972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38216972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31298322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16585163, 17606309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17606309, 22162216, 28662214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	18038152, 20338664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18851835	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22537942	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24811343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15338470, 17131366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10352938, 20186023, 20338664, 22866867, 22882865, 24332178, 25441176, 26923134, 28662214, 29176597, 29199590, 30675268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31539121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23158838, 28727371, 31081081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31318608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20338664, 23200847, 24332178, 24486491, 26782095, 26923134, 28662214, 29176597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30964162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17131366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse	Mitral valve prolapse	Pubtator	37180137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10508479, 11029660, 17131366, 17606309, 18038152, 20186023, 20338664, 22537942, 22866867, 22882865, 23158838, 23721095, 24332178, 24486491, 25441176 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12036935, 17606309, 22537942, 22882865, 25441176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38031049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33816613	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23200847, 31539121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31539121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23158838, 28727371, 31081081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23158838	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28727371, 31081081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10508479, 28662214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28662214	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31869662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	31318608		★★★★★ ★☆☆☆☆ Found in Text Mining only

RBM5 (RNA binding motif protein 5)