Gene Gene information from NCBI Gene database.
Entrez ID 10179
Gene name RNA binding motif protein 7
Gene symbol RBM7
Synonyms (NCBI Gene)
-
Chromosome 11
Chromosome location 11q23.2
miRNA miRNA information provided by mirtarbase database.
239
miRTarBase ID miRNA Experiments Reference
MIRT045565 hsa-miR-149-5p CLASH 23622248
MIRT546799 hsa-miR-3908 PAR-CLIP 21572407
MIRT546798 hsa-miR-875-5p PAR-CLIP 21572407
MIRT546797 hsa-miR-410-3p PAR-CLIP 21572407
MIRT546796 hsa-miR-5009-3p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IBA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IDA 25578728, 30824372
GO:0003723 Function RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612413 9904 ENSG00000076053
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y580
Protein name RNA-binding protein 7 (RNA-binding motif protein 7)
Protein function RNA-binding subunit of the trimeric nuclear exosome targeting (NEXT) complex, a complex that functions as an RNA exosome cofactor that directs a subset of non-coding short-lived RNAs for exosomal degradation (PubMed:25189701, PubMed:25525152, Pu
PDB 2M8H , 5IQQ , 5LXR , 5LXY , 7S7B , 7S7C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 12 81 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHE
VSVPYAMNLLNGIKLYGRPIK
IQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERT
MDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHS
FNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDR
NHDDWSHDYDNRRDSSRDGKWRSSRH
Sequence length 266
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, NON-SMALL-CELL LUNG CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Central nervous system demyelination Central Nervous System Demyelination BEFREE 29727687
★☆☆☆☆
Found in Text Mining only
Congenital pontocerebellar hypoplasia Pontoneocerebellar hypoplasia BEFREE 29727687
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Myeloid leukemia Pubtator 34343137 Associate
★☆☆☆☆
Found in Text Mining only
Non-Small Cell Lung Carcinoma Lung carcinoma CTD_human_DG 15496427
★☆☆☆☆
Found in Text Mining only
Peripheral motor neuropathy Motor nerve neuritis BEFREE 27193168
★☆☆☆☆
Found in Text Mining only
Pontoneocerebellar hypoplasia Pontoneocerebellar hypoplasia BEFREE 29727687
★☆☆☆☆
Found in Text Mining only
Spinal Muscular Atrophy Spinal Muscular Atrophy BEFREE 27193168
★☆☆☆☆
Found in Text Mining only