TENM1 (teneurin transmembrane protein 1)

Gene

• Entrez ID: 10178
• Gene name: Teneurin transmembrane protein 1
• Gene symbol: TENM1
• Synonyms (NCBI Gene): ODZ1, ODZ3, TEN-M1, TEN1, TNM, TNM1, ten-1
• Chromosome: X
• Chromosome location: Xq25
• Summary: The protein encoded by this gene belongs to the tenascin family and teneurin subfamily. It is expressed in the neurons and may function as a cellular signal transducer. Several alternatively spliced transcript variants encoding different isoforms have bee

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT717443	hsa-miR-215-3p	HITS-CLIP	19536157
MIRT717442	hsa-miR-626	HITS-CLIP	19536157
MIRT717441	hsa-miR-6876-3p	HITS-CLIP	19536157
MIRT717440	hsa-miR-4536-5p	HITS-CLIP	19536157
MIRT717439	hsa-miR-6516-3p	HITS-CLIP	19536157
MIRT717438	hsa-miR-5696	HITS-CLIP	19536157
MIRT717437	hsa-miR-579-3p	HITS-CLIP	19536157
MIRT717436	hsa-miR-664b-3p	HITS-CLIP	19536157
MIRT717435	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT717434	hsa-miR-8060	HITS-CLIP	19536157
MIRT717433	hsa-miR-7154-5p	HITS-CLIP	19536157
MIRT441816	hsa-miR-5680	PAR-CLIP	22100165
MIRT441815	hsa-miR-4698	PAR-CLIP	22100165
MIRT441814	hsa-miR-4778-3p	PAR-CLIP	22100165
MIRT441812	hsa-miR-3653-3p	PAR-CLIP	22100165
MIRT441813	hsa-miR-3658	PAR-CLIP	22100165
MIRT441811	hsa-miR-4659a-3p	PAR-CLIP	22100165
MIRT441810	hsa-miR-4659b-3p	PAR-CLIP	22100165
MIRT441816	hsa-miR-5680	PAR-CLIP	22100165
MIRT441815	hsa-miR-4698	PAR-CLIP	22100165
MIRT441814	hsa-miR-4778-3p	PAR-CLIP	22100165
MIRT441812	hsa-miR-3653-3p	PAR-CLIP	22100165
MIRT441813	hsa-miR-3658	PAR-CLIP	22100165
MIRT441811	hsa-miR-4659a-3p	PAR-CLIP	22100165
MIRT441810	hsa-miR-4659b-3p	PAR-CLIP	22100165
MIRT717443	hsa-miR-215-3p	HITS-CLIP	19536157
MIRT717442	hsa-miR-626	HITS-CLIP	19536157
MIRT717441	hsa-miR-6876-3p	HITS-CLIP	19536157
MIRT717440	hsa-miR-4536-5p	HITS-CLIP	19536157
MIRT717439	hsa-miR-6516-3p	HITS-CLIP	19536157
MIRT717438	hsa-miR-5696	HITS-CLIP	19536157
MIRT717437	hsa-miR-579-3p	HITS-CLIP	19536157
MIRT717436	hsa-miR-664b-3p	HITS-CLIP	19536157
MIRT717435	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT717434	hsa-miR-8060	HITS-CLIP	19536157
MIRT717433	hsa-miR-7154-5p	HITS-CLIP	19536157
MIRT441816	hsa-miR-5680	PAR-CLIP	22100165
MIRT441815	hsa-miR-4698	PAR-CLIP	22100165
MIRT441814	hsa-miR-4778-3p	PAR-CLIP	22100165
MIRT441812	hsa-miR-3653-3p	PAR-CLIP	22100165
MIRT441813	hsa-miR-3658	PAR-CLIP	22100165
MIRT441811	hsa-miR-4659a-3p	PAR-CLIP	22100165
MIRT441810	hsa-miR-4659b-3p	PAR-CLIP	22100165
MIRT441816	hsa-miR-5680	PAR-CLIP	22100165
MIRT441815	hsa-miR-4698	PAR-CLIP	22100165
MIRT441814	hsa-miR-4778-3p	PAR-CLIP	22100165
MIRT441812	hsa-miR-3653-3p	PAR-CLIP	22100165
MIRT441813	hsa-miR-3658	PAR-CLIP	22100165
MIRT441811	hsa-miR-4659a-3p	PAR-CLIP	22100165
MIRT441810	hsa-miR-4659b-3p	PAR-CLIP	22100165

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	TAS	10341219
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005794	Component	Golgi apparatus	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006359	Process	Regulation of transcription by RNA polymerase III	ISS
GO:0006955	Process	Immune response	TAS	10556288
GO:0007165	Process	Signal transduction	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007399	Process	Nervous system development	TAS	10341219
GO:0008201	Function	Heparin binding	TAS	10341219
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	10556288
GO:0016020	Component	Membrane	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0016363	Component	Nuclear matrix	ISS
GO:0016607	Component	Nuclear speck	IEA
GO:0016607	Component	Nuclear speck	ISS
GO:0030838	Process	Positive regulation of actin filament polymerization	ISS
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IBA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043005	Component	Neuron projection	IBA
GO:0043406	Process	Positive regulation of MAP kinase activity	ISS
GO:0046982	Function	Protein heterodimerization activity	IBA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048666	Process	Neuron development	IBA
GO:0050839	Function	Cell adhesion molecule binding	IBA
GO:0051491	Process	Positive regulation of filopodium assembly	ISS
GO:0090316	Process	Positive regulation of intracellular protein transport	ISS

Other IDs

• MIM: 300588
• HGNC: 8117
• e!Ensembl: ENSG00000009694

Protein

• UniProt ID: Q9UKZ4
• Protein name: Teneurin-1 (Ten-1) (Protein Odd Oz/ten-m homolog 1) (Tenascin-M1) (Ten-m1) (Teneurin transmembrane protein 1) [Cleaved into: Ten-1 intracellular domain (IDten-1) (Ten-1 ICD); Teneurin C-terminal-associated peptide (TCPA-1) (Ten-1 extracellular domain) (Te
• Protein function: Involved in neural development, regulating the establishment of proper connectivity within the nervous system. May function as a cellular signal transducer (By similarity). ; [Teneurin C-terminal-associated peptide]: Play
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06484	Ten_N	14 → 180	Teneurin Intracellular Region	Family
  PF06484	Ten_N	164 → 317	Teneurin Intracellular Region	Family
  PF15636	Tox-GHH	2641 → 2718	GHH signature containing HNH/Endo VII superfamily nuclease toxin	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal brain. {ECO:0000269|PubMed:10341219}.
• Sequence:

  MEQTDCKPYQPLPKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQ
  SRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVDTETEGAASPDHA
  LRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDV
  QSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTSTQD
  SVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTF
  SRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGELYANG
  VSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRF
  QITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDDTQ
  HSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
  ECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRHGWKGPECDVPEEQCIDPT
  CFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSNHGICVKGECHCSTGWGGVNCETPLP
  VCQEQCSGHGTFLLDAGVCSCDPKWTGSDCSTELCTMECGSHGVCSRGICQCEEGWVGPT
  CEERSCHSHCTEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQN
  GWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYISPLCQGSPDP
  LDLIQQSQTLFSQHTSRLFYDRIKFLIGKDSTHVIPPEVSFDSRRACVIRGQVVAIDGTP
  LVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVILIFDRSPFLPEKRTLWLPWNQFIV
  VEKVTMQRVVSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPIP
  SSFVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGRLTQKWFPAAINLVYT
  FAWNKTDIYGQKVWGLAEALVSVGYEYETCPDFILWEQRTVVLQGFEMDASNLGGWSLNK
  HHILNPQSGIIHKGNGENMFISQQPPVISTIMGNGHQRSVACTNCNGPAHNNKLFAPVAL
  ASGPDGSVYVGDFNFVRRIFPSGNSVSILELSTSPAHKYYLAMDPVSESLYLSDTNTRKV
  YKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITVDRHGFIY
  FVDGTMIRKIDENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLY
  VLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGLLF
  IAETDERKVNRIQQVTTNGEIYIIAGAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPSSL
  AVSPDGTLYVADLGNVRIRTISRNQAHLNDMNIYEIASPADQELYQFTVNGTHLHTLNLI
  TRDYVYNFTYNSEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKR
  VSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLEK
  LTKVELDTSNRENVLMSTNLTATSTIYILKQENTQSTYRVNPDGSLRVTFASGMEIGLSS
  EPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQNKGNVSAFERRLRAHNRNLLSID
  FDHITRTGKIYDDHRKFTLRILYDQTGRPILWSPVSRYNEVNITYSPSGLVTFIQRGTWN
  EKMEYDQSGKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQPDCLLSVTMPSMV
  RHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYTKQARLSE
  VLYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFD
  YSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTK
  IFSANGQVIEVQYEILKAIAYWMTIQYDNVGRMVICDIRVGVDANITRYFYEYDADGQLQ
  TVSVNDKTQWRYSYDLNGNINLLSHGKSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQ
  RGNDIFEYNSNGLLQKAYNKASGWTVQYYYDGLGRRVASKSSLGQHLQFFYADLTNPIRV
  THLYNHTSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSSRGQVIKEILYT
  PYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDVVAGRWTTPNHHIWKQLNLLP
  KPFNLYSFENNYPVGKIQDVAKYTTDIRSWLELFGFQLHNVLPGFPKPELENLELTYELL
  RLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYNDGRCLEGGKQPRFAAVPS
  VFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTHYFIKLGS
  LEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRYGTTVE
  EEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLS
  VEQYLELSDSANNIHFMRQSEIGRR

• Sequence length: 2725

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Moyamoya angiopathy	Likely pathogenic	rs2060637524	RCV004704496	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANOSMIA	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL PALSY	—	Disgenet, GenCC Disgenet, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ANOSMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensorineural hearing loss disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TENM1-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	28921449		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28881680		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	24641834	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	15710242		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	15710242		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	38183111	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	30392976	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	20955617	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20972741, 22692639, 28940301		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19649706, 22245916, 22496908, 23558933, 25990212, 26339424, 26406239, 27983523, 29719533, 30941950, 31197914, 31790361, 32521854, 32616754, 32618397, 33380715, 33694315, 33971623, 34082648, 34218256, 34362383, 36797689	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	26261522	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15884108, 20977315, 22022601, 25162823, 25638165, 25755745, 26045820, 26191242, 26505457, 28152516, 28821282, 29252188, 29271999, 30473552, 32337237, 33015773, 33435769, 33906640, 34338154, 34522182, 35812416, 36849926, 36936971, 38015711, 38164181, 39244092	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31163629		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25520129, 33341545	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11920465, 16340244, 22133010, 24714746, 25826081, 26631537, 26926076, 27050271, 27861513, 32717723, 33710368, 34825321, 35120484, 35525866, 35840930, 36083857, 36097369, 36292781, 37304674, 37729738, 37964226	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27748889, 29394946, 35400998, 35611464, 36936942	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26014518, 31059014, 34898474	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	16279911		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27732955	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23876008, 28967380, 29175261		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19437569, 20193112, 21533144, 22125029, 22458985, 24560444, 24852431, 24972972, 24978917, 25005166, 25824781, 26339368, 26617820, 26836283, 27350737, 27453340, 27543107, 27639612, 27793161, 27888614, 28465494, 28835319, 29749460, 29762830, 29795620, 29970892, 30126852, 30892955, 30944670, 31350343, 31574832, 31682231, 31683723, 32049807, 32115493, 32484056, 33214609, 33622275, 33827593, 34193174, 34371180, 34373442, 34699318, 34717544, 35034031, 35469225, 35593476, 36103642, 36177832, 36397308, 36841801, 37999119, 38172565	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28801584, 31186036, 36806160, 39521798	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36503344	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital anosmia	Congenital Anosmia	ORPHANET_DG	27040985		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	22271700		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	12632485, 26823803, 27420968, 32103875, 32536038, 33818145, 34046994, 36247858, 7559092	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21556122, 23955799, 24188482, 24272087, 26662958, 27044807, 29397026, 29747775, 30611100, 32005248, 32572924, 32589328, 33432363, 36267307, 37017121, 37417427	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	30086773, 31882471	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	25400808	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27641332, 31649891		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34376733, 35054927	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27641332, 31649891		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35140722	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	33713422	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35054927	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37180146	Associate	★☆☆☆☆ Found in Text Mining only
Isolated congenital anosmia	Isolated Congenital Anosmia	Orphanet			★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28052013	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26847279		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21556757, 26376879		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22528947, 24070213, 26860827, 29935018, 30176158, 32646340, 32772818, 39258530, 39311787, 8611403	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	11449307	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36454780	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20972741, 22692639, 28940301		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31163629		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20372786, 28940301		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16279911		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	37147569	Associate	★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	22766609		★☆☆☆☆ Found in Text Mining only
Microphthalmos co-occurrent with congenital ocular coloboma	Microphthalmos Co-Occurrent With Congenital Ocular Coloboma	BEFREE	27103084		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25511050	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18171482, 26191775, 26310711, 26634210, 27629742, 27658775, 28389646, 30361907, 31375471, 31884829, 34165442, 34994235, 39265506	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	27048285	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11820617, 16279911, 17214375, 19526206, 20372786, 22287761, 22692639, 23645774, 25750281, 31163629, 31649891		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	29135092	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27396430, 29194827, 30840263	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31539115, 31985007	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22458379, 24667580, 27447976, 30178840, 30575904, 33341545, 36782176	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28004221, 31646573		★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	37763742	Associate	★☆☆☆☆ Found in Text Mining only
Pleomorphic Xanthoastrocytoma	Pleomorphic Xanthoastrocytoma	BEFREE	26238627		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31421977, 33460399, 37971439	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	29670090	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19526206		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26311049, 28338203, 28384094, 28539817, 30454973, 30556871, 32641093, 32661668, 32711434, 32993417, 34164962, 34257607, 34416845, 35813482, 37986347	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12854132, 15655810, 15849807, 16830385, 19865524, 20164037, 22017425, 22246605, 22296392, 23722300, 23870553, 23936528, 23980896, 24063685, 24116074, 24175801, 24712400, 25197381, 25220301, 25337233, 25741138, 26191203, 26261590, 26514456, 26738864, 26823707, 27793161, 28293092, 28440445, 29036784, 29416011, 31005794, 31526099, 31722712, 31814518, 32462010, 32495872, 32632900, 33316803, 33993193, 34953081, 35027539, 35123909, 35770962, 36098904, 36241983, 36316865, 36454780, 36479114, 36793271, 37545221, 38166744, 8795580	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	11752453, 25674762, 27929737, 29321094, 30986203, 36193505, 36465624, 37733241	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22577338, 32164602, 32633373, 34221185, 40198658	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	23083099	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33495420	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26503215, 27015551, 28445936, 28869948, 29917188, 33888644, 34530089, 34565011, 39578844	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	36675289	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25550851, 26436510, 29509241	Associate	★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	22271700		★☆☆☆☆ Found in Text Mining only