Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10171
Gene name	RNA terminal phosphate cyclase like 1
Gene symbol	RCL1
Synonyms (NCBI Gene)	RNACRPCL1
Chromosome	9
Chromosome location	9p24.1

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031762	hsa-miR-16-5p	Proteomics	18668040
MIRT031762	hsa-miR-16-5p	CLASH	23622248
MIRT1298316	hsa-miR-1225-3p	CLIP-seq
MIRT1298317	hsa-miR-1228	CLIP-seq
MIRT1298318	hsa-miR-1245b-3p	CLIP-seq
MIRT1298319	hsa-miR-1270	CLIP-seq
MIRT1298320	hsa-miR-3120-3p	CLIP-seq
MIRT1298321	hsa-miR-3121-3p	CLIP-seq
MIRT1298322	hsa-miR-3660	CLIP-seq
MIRT1298323	hsa-miR-374c	CLIP-seq
MIRT1298324	hsa-miR-4256	CLIP-seq
MIRT1298325	hsa-miR-432	CLIP-seq
MIRT1298326	hsa-miR-4526	CLIP-seq
MIRT1298327	hsa-miR-4666-3p	CLIP-seq
MIRT1298328	hsa-miR-4683	CLIP-seq
MIRT1298329	hsa-miR-4699-5p	CLIP-seq
MIRT1298330	hsa-miR-4762-3p	CLIP-seq
MIRT1298331	hsa-miR-490-5p	CLIP-seq
MIRT1298332	hsa-miR-499-3p	CLIP-seq
MIRT1298333	hsa-miR-499a-3p	CLIP-seq
MIRT1298334	hsa-miR-577	CLIP-seq
MIRT1298335	hsa-miR-619	CLIP-seq
MIRT1298336	hsa-miR-620	CLIP-seq
MIRT1298337	hsa-miR-655	CLIP-seq
MIRT2088752	hsa-miR-124	CLIP-seq
MIRT2088753	hsa-miR-3145-3p	CLIP-seq
MIRT2088754	hsa-miR-506	CLIP-seq
MIRT2313638	hsa-miR-4729	CLIP-seq
MIRT2313639	hsa-miR-4733-5p	CLIP-seq
MIRT2313640	hsa-miR-548ac	CLIP-seq
MIRT2313641	hsa-miR-548d-3p	CLIP-seq
MIRT2313642	hsa-miR-548z	CLIP-seq
MIRT2313643	hsa-miR-607	CLIP-seq
MIRT2313644	hsa-miR-890	CLIP-seq
MIRT2610200	hsa-miR-1184	CLIP-seq
MIRT2088752	hsa-miR-124	CLIP-seq
MIRT2610201	hsa-miR-1279	CLIP-seq
MIRT2610202	hsa-miR-1301	CLIP-seq
MIRT2610203	hsa-miR-15a	CLIP-seq
MIRT2610204	hsa-miR-15b	CLIP-seq
MIRT2610205	hsa-miR-16	CLIP-seq
MIRT2610206	hsa-miR-195	CLIP-seq
MIRT2610207	hsa-miR-3065-5p	CLIP-seq
MIRT2610208	hsa-miR-3162-3p	CLIP-seq
MIRT2610209	hsa-miR-3173-3p	CLIP-seq
MIRT2610210	hsa-miR-3545-3p	CLIP-seq
MIRT2610211	hsa-miR-3689d	CLIP-seq
MIRT2610212	hsa-miR-3714	CLIP-seq
MIRT2610213	hsa-miR-3910	CLIP-seq
MIRT2610214	hsa-miR-3915	CLIP-seq
MIRT2610215	hsa-miR-3928	CLIP-seq
MIRT2610216	hsa-miR-3929	CLIP-seq
MIRT2610217	hsa-miR-424	CLIP-seq
MIRT2610218	hsa-miR-425	CLIP-seq
MIRT2610219	hsa-miR-4252	CLIP-seq
MIRT2610220	hsa-miR-4318	CLIP-seq
MIRT2610221	hsa-miR-4418	CLIP-seq
MIRT2610222	hsa-miR-4419b	CLIP-seq
MIRT2610223	hsa-miR-4446-3p	CLIP-seq
MIRT2610224	hsa-miR-4464	CLIP-seq
MIRT2610225	hsa-miR-4478	CLIP-seq
MIRT2610226	hsa-miR-4493	CLIP-seq
MIRT2610227	hsa-miR-450b-5p	CLIP-seq
MIRT2610228	hsa-miR-4524	CLIP-seq
MIRT2610229	hsa-miR-4539	CLIP-seq
MIRT2610230	hsa-miR-4656	CLIP-seq
MIRT2610231	hsa-miR-4660	CLIP-seq
MIRT2610232	hsa-miR-4691-5p	CLIP-seq
MIRT2610233	hsa-miR-4721	CLIP-seq
MIRT2313638	hsa-miR-4729	CLIP-seq
MIRT2610234	hsa-miR-4748	CLIP-seq
MIRT2610235	hsa-miR-497	CLIP-seq
MIRT2610236	hsa-miR-502-5p	CLIP-seq
MIRT2610237	hsa-miR-503	CLIP-seq
MIRT2610238	hsa-miR-5047	CLIP-seq
MIRT2088754	hsa-miR-506	CLIP-seq
MIRT2610239	hsa-miR-509-3-5p	CLIP-seq
MIRT2610240	hsa-miR-509-5p	CLIP-seq
MIRT2610241	hsa-miR-518a-5p	CLIP-seq
MIRT2610242	hsa-miR-527	CLIP-seq
MIRT2610243	hsa-miR-548aa	CLIP-seq
MIRT2313640	hsa-miR-548ac	CLIP-seq
MIRT2313641	hsa-miR-548d-3p	CLIP-seq
MIRT2313642	hsa-miR-548z	CLIP-seq
MIRT2610244	hsa-miR-646	CLIP-seq
MIRT2610245	hsa-miR-656	CLIP-seq
MIRT2610246	hsa-miR-663b	CLIP-seq
MIRT2610247	hsa-miR-671-5p	CLIP-seq
MIRT2610200	hsa-miR-1184	CLIP-seq
MIRT2088752	hsa-miR-124	CLIP-seq
MIRT2610203	hsa-miR-15a	CLIP-seq
MIRT2610204	hsa-miR-15b	CLIP-seq
MIRT2610205	hsa-miR-16	CLIP-seq
MIRT2610206	hsa-miR-195	CLIP-seq
MIRT2610210	hsa-miR-3545-3p	CLIP-seq
MIRT2610214	hsa-miR-3915	CLIP-seq
MIRT2610215	hsa-miR-3928	CLIP-seq
MIRT2610216	hsa-miR-3929	CLIP-seq
MIRT2610217	hsa-miR-424	CLIP-seq
MIRT2610218	hsa-miR-425	CLIP-seq
MIRT2610220	hsa-miR-4318	CLIP-seq
MIRT2610221	hsa-miR-4418	CLIP-seq
MIRT2610222	hsa-miR-4419b	CLIP-seq
MIRT2610223	hsa-miR-4446-3p	CLIP-seq
MIRT2610224	hsa-miR-4464	CLIP-seq
MIRT2610225	hsa-miR-4478	CLIP-seq
MIRT2610226	hsa-miR-4493	CLIP-seq
MIRT2610227	hsa-miR-450b-5p	CLIP-seq
MIRT2610228	hsa-miR-4524	CLIP-seq
MIRT2610229	hsa-miR-4539	CLIP-seq
MIRT2610230	hsa-miR-4656	CLIP-seq
MIRT2610232	hsa-miR-4691-5p	CLIP-seq
MIRT2610233	hsa-miR-4721	CLIP-seq
MIRT2610234	hsa-miR-4748	CLIP-seq
MIRT2610235	hsa-miR-497	CLIP-seq
MIRT2610237	hsa-miR-503	CLIP-seq
MIRT2088754	hsa-miR-506	CLIP-seq
MIRT2610239	hsa-miR-509-3-5p	CLIP-seq
MIRT2610240	hsa-miR-509-5p	CLIP-seq
MIRT2610241	hsa-miR-518a-5p	CLIP-seq
MIRT2610242	hsa-miR-527	CLIP-seq
MIRT2610244	hsa-miR-646	CLIP-seq
MIRT2610246	hsa-miR-663b	CLIP-seq
MIRT2610247	hsa-miR-671-5p	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000447	Process	Endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA
GO:0000479	Process	Endonucleolytic cleavage of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA
GO:0000480	Process	Endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004521	Function	RNA endonuclease activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IEA
GO:0006396	Process	RNA processing	IEA
GO:0031981	Component	Nuclear lumen	IEA
GO:0032040	Component	Small-subunit processome	IDA	34516797
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042274	Process	Ribosomal small subunit biogenesis	IDA	34516797
GO:0042274	Process	Ribosomal small subunit biogenesis	IEA

MIM	HGNC	e!Ensembl
611405	17687	ENSG00000120158

Q9Y2P8

Protein name

RNA 3'-terminal phosphate cyclase-like protein

Protein function

As part of the small subunit (SSU) processome, it plays a role in 40S-ribosomal-subunit biogenesis in the early pre-rRNA processing steps at sites A0, A1 and A2 that are required for proper maturation of the 18S RNA (By similarity). Activates BM

PDB

7MQ8 , 7MQ9 , 7MQA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01137	RTC	8 → 341		Domain
PF05189	RTC_insert	183 → 288		Domain

Sequence

MATQAHSLSYAGCNFLRQRLVLSTLSGRPVKIRKIRARDDNPGLRDFEASFIRLLDKITN
GSRIEINQTGTTLYYQPGLLYGGSVEHDCSVLRGIGYYLESLLCLAPFMKHPLKIVLRGV
TNDQVDPSVDVLKATALPLLKQFGIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPI
QLTDPGKIKRIRGMAYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVNSGKSPG
FGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCARLLLEEIYRGGCVDSTNQSL
ALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEELKGGDKVLMTC
VGIGFSNLSKTLK

Sequence length

373

Interactions

View interactions

	KEGG		Reactome
	Ribosome biogenesis in eukaryotes		Major pathway of rRNA processing in the nucleolus and cytosol

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Psychotic disorder	Pathogenic	rs1816786087	RCV001376129	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER'S DISEASE NEUROPATHOLOGIC CHANGE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24475105, 35441810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Catatonia	Catatonia	Pubtator	33597717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31235766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31235766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28322274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28322274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	33597717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	33597717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32911699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RCL1 (RNA terminal phosphate cyclase like 1)