Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10164
Gene name	Carbohydrate sulfotransferase 4
Gene symbol	CHST4
Synonyms (NCBI Gene)	GST3GlcNAc6ST2HECGLCNAC6STLSST
Chromosome	16
Chromosome location	16q22.2
Summary	This gene encodes an N-acetylglucosamine 6-O sulfotransferase. The encoded enzyme transfers sulfate from 3`phosphoadenosine 5`phospho-sulfate to the 6-hydroxyl group of N-acetylglucosamine on glycoproteins. This protein is localized to the Golgi and is in

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029010	hsa-miR-26b-5p	Microarray	19088304
MIRT718131	hsa-miR-3145-5p	HITS-CLIP	19536157
MIRT718130	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT718129	hsa-miR-1273g-3p	HITS-CLIP	19536157
MIRT718128	hsa-miR-5695	HITS-CLIP	19536157
MIRT718127	hsa-miR-204-3p	HITS-CLIP	19536157
MIRT718126	hsa-miR-4646-5p	HITS-CLIP	19536157
MIRT718125	hsa-miR-1292-5p	HITS-CLIP	19536157
MIRT718124	hsa-miR-4471	HITS-CLIP	19536157
MIRT718123	hsa-miR-8059	HITS-CLIP	19536157
MIRT718122	hsa-miR-6509-3p	HITS-CLIP	19536157
MIRT718131	hsa-miR-3145-5p	HITS-CLIP	19536157
MIRT718130	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT718129	hsa-miR-1273g-3p	HITS-CLIP	19536157
MIRT718128	hsa-miR-5695	HITS-CLIP	19536157
MIRT718127	hsa-miR-204-3p	HITS-CLIP	19536157
MIRT718126	hsa-miR-4646-5p	HITS-CLIP	19536157
MIRT718125	hsa-miR-1292-5p	HITS-CLIP	19536157
MIRT718124	hsa-miR-4471	HITS-CLIP	19536157
MIRT718123	hsa-miR-8059	HITS-CLIP	19536157
MIRT718122	hsa-miR-6509-3p	HITS-CLIP	19536157
MIRT718131	hsa-miR-3145-5p	HITS-CLIP	19536157
MIRT718130	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT718129	hsa-miR-1273g-3p	HITS-CLIP	19536157
MIRT718128	hsa-miR-5695	HITS-CLIP	19536157
MIRT718127	hsa-miR-204-3p	HITS-CLIP	19536157
MIRT718126	hsa-miR-4646-5p	HITS-CLIP	19536157
MIRT718125	hsa-miR-1292-5p	HITS-CLIP	19536157
MIRT718124	hsa-miR-4471	HITS-CLIP	19536157
MIRT718123	hsa-miR-8059	HITS-CLIP	19536157
MIRT718122	hsa-miR-6509-3p	HITS-CLIP	19536157
MIRT718131	hsa-miR-3145-5p	HITS-CLIP	19536157
MIRT718130	hsa-miR-181a-2-3p	HITS-CLIP	19536157
MIRT718129	hsa-miR-1273g-3p	HITS-CLIP	19536157
MIRT718128	hsa-miR-5695	HITS-CLIP	19536157
MIRT718127	hsa-miR-204-3p	HITS-CLIP	19536157
MIRT718126	hsa-miR-4646-5p	HITS-CLIP	19536157
MIRT718125	hsa-miR-1292-5p	HITS-CLIP	19536157
MIRT718124	hsa-miR-4471	HITS-CLIP	19536157
MIRT718123	hsa-miR-8059	HITS-CLIP	19536157
MIRT718122	hsa-miR-6509-3p	HITS-CLIP	19536157
MIRT892448	hsa-miR-3614-3p	CLIP-seq
MIRT892449	hsa-miR-513c	CLIP-seq
MIRT892450	hsa-miR-514b-5p	CLIP-seq
MIRT892451	hsa-miR-545	CLIP-seq
MIRT1964507	hsa-miR-1264	CLIP-seq
MIRT1964508	hsa-miR-27a	CLIP-seq
MIRT1964509	hsa-miR-27b	CLIP-seq
MIRT1964510	hsa-miR-3973	CLIP-seq
MIRT1964511	hsa-miR-513a-5p	CLIP-seq
MIRT1964512	hsa-miR-520g	CLIP-seq
MIRT1964513	hsa-miR-520h	CLIP-seq
MIRT2447043	hsa-miR-1179	CLIP-seq
MIRT2447044	hsa-miR-24	CLIP-seq
MIRT2447045	hsa-miR-3919	CLIP-seq
MIRT2447046	hsa-miR-4756-3p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
GATA3	Activation	22446378
SP1	Activation	22446378
TBX21	Activation	22446378

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	NAS	12855678
GO:0000139	Component	Golgi membrane	TAS
GO:0001517	Function	N-acetylglucosamine 6-O-sulfotransferase activity	IBA
GO:0001517	Function	N-acetylglucosamine 6-O-sulfotransferase activity	IDA	10330415
GO:0001517	Function	N-acetylglucosamine 6-O-sulfotransferase activity	IEA
GO:0001517	Function	N-acetylglucosamine 6-O-sulfotransferase activity	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005802	Component	Trans-Golgi network	IDA	12855678
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0006044	Process	N-acetylglucosamine metabolic process	IBA
GO:0006044	Process	N-acetylglucosamine metabolic process	IDA	10330415
GO:0006044	Process	N-acetylglucosamine metabolic process	IEA
GO:0006477	Process	Protein sulfation	TAS	10330415
GO:0006790	Process	Sulfur compound metabolic process	IBA
GO:0006790	Process	Sulfur compound metabolic process	IDA	10330415
GO:0006790	Process	Sulfur compound metabolic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	TAS	10330415
GO:0007155	Process	Cell adhesion	TAS	10330415
GO:0007267	Process	Cell-cell signaling	TAS	10330415
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008146	Function	Sulfotransferase activity	TAS	10330415
GO:0016020	Component	Membrane	IEA
GO:0016266	Process	Protein O-linked glycosylation via N-acetyl-galactosamine	TAS
GO:0016740	Function	Transferase activity	IEA
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	ISS

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8NCG5

Protein name

Carbohydrate sulfotransferase 4 (EC 2.8.2.-) (Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3) (GST-3) (High endothelial cells N-acetylglucosamine 6-O-sulfotransferase) (HEC-GlcNAc6ST) (L-selectin ligand sulfotransferase) (LSST) (

Protein function

Sulfotransferase involved in SELL/L-selectin ligand biosynthesis pathway. Catalyzes the transfer of the sulfate group from 3'-phospho-5'-adenylyl sulfate (PAPS) onto the hydroxyl group at C-6 position of the non-reducing N-acetylglucosamine (Glc

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00685	Sulfotransfer_1	42 → 358	Sulfotransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in HEV. Weakly expressed in spleen. Not expressed in other tissues. Expressed in colonic mucinous adenocarcinoma. {ECO:0000269|PubMed:10330415, ECO:0000269|PubMed:11310842, ECO:0000269|PubMed:12107080}.

Sequence

MLLPKKMKLLLFLVSQMAILALFFHMYSHNISSLSMKAQPERMHVLVLSSWRSGSSFVGQ
LFGQHPDVFYLMEPAWHVWMTFKQSTAWMLHMAVRDLIRAVFLCDMSVFDAYMEPGPRRQ
SSLFQWENSRALCSAPACDIIPQDEIIPRAHCRLLCSQQPFEVVEKACRSYSHVVLKEVR
FFNLQSLYPLLKDPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKED
QPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLP
HLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYR
HVRSEQEQRNLLLDLLSTWTVPEQIH

Sequence length

386

Interactions

View interactions

	KEGG		Reactome
	Glycosaminoglycan biosynthesis - keratan sulfate		O-linked glycosylation of mucins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	12107080, 16897186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16897186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15752429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33741523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	36010590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29350564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30093410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15752429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	1684084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30093410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	12107080, 16897186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	LHGDN	12107080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	1684084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1684084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15752429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34965257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CHST4 (carbohydrate sulfotransferase 4)