Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10160
Gene name	FERM, ARH/RhoGEF and pleckstrin domain protein 1
Gene symbol	FARP1
Synonyms (NCBI Gene)	CDEPFARP1-IT1GLCC1PLEKHC2PPP1R75
Chromosome	13
Chromosome location	13q32.2
Summary	This gene encodes a protein containing a FERM (4.2, exrin, radixin, moesin) domain, a Dbl homology domain, and two pleckstrin homology domains. These domains are found in guanine nucleotide exchange factors and proteins that link the cytoskeleton to the c

279

Show/Hide all (279)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005052	hsa-let-7b-5p	Microarray	17699775
MIRT005826	hsa-miR-204-5p	Microarray	21282569
MIRT023200	hsa-miR-124-3p	Microarray	18668037
MIRT030304	hsa-miR-26b-5p	Microarray	19088304
MIRT053628	hsa-let-7f-5p	Microarray	22942087
MIRT989371	hsa-let-7a	CLIP-seq
MIRT989372	hsa-let-7b	CLIP-seq
MIRT989373	hsa-let-7c	CLIP-seq
MIRT989374	hsa-let-7d	CLIP-seq
MIRT989375	hsa-let-7e	CLIP-seq
MIRT989376	hsa-let-7f	CLIP-seq
MIRT989377	hsa-let-7g	CLIP-seq
MIRT989378	hsa-let-7i	CLIP-seq
MIRT989379	hsa-miR-1206	CLIP-seq
MIRT989380	hsa-miR-1243	CLIP-seq
MIRT989381	hsa-miR-1254	CLIP-seq
MIRT989382	hsa-miR-1271	CLIP-seq
MIRT989383	hsa-miR-1278	CLIP-seq
MIRT989384	hsa-miR-1287	CLIP-seq
MIRT989385	hsa-miR-1298	CLIP-seq
MIRT989386	hsa-miR-1324	CLIP-seq
MIRT989387	hsa-miR-146b-3p	CLIP-seq
MIRT989388	hsa-miR-1537	CLIP-seq
MIRT989389	hsa-miR-182	CLIP-seq
MIRT989390	hsa-miR-202	CLIP-seq
MIRT989391	hsa-miR-204	CLIP-seq
MIRT989392	hsa-miR-211	CLIP-seq
MIRT989393	hsa-miR-25	CLIP-seq
MIRT989394	hsa-miR-3116	CLIP-seq
MIRT989395	hsa-miR-3117-5p	CLIP-seq
MIRT989396	hsa-miR-3120-3p	CLIP-seq
MIRT989397	hsa-miR-3135b	CLIP-seq
MIRT989398	hsa-miR-3152-5p	CLIP-seq
MIRT989399	hsa-miR-3157-3p	CLIP-seq
MIRT989400	hsa-miR-3163	CLIP-seq
MIRT989401	hsa-miR-3173-5p	CLIP-seq
MIRT989402	hsa-miR-32	CLIP-seq
MIRT989403	hsa-miR-339-5p	CLIP-seq
MIRT989404	hsa-miR-3591-3p	CLIP-seq
MIRT989405	hsa-miR-363	CLIP-seq
MIRT989406	hsa-miR-3654	CLIP-seq
MIRT989407	hsa-miR-3659	CLIP-seq
MIRT989408	hsa-miR-367	CLIP-seq
MIRT989409	hsa-miR-374c	CLIP-seq
MIRT989410	hsa-miR-3938	CLIP-seq
MIRT989411	hsa-miR-4261	CLIP-seq
MIRT989412	hsa-miR-4307	CLIP-seq
MIRT989413	hsa-miR-431	CLIP-seq
MIRT989414	hsa-miR-4421	CLIP-seq
MIRT989415	hsa-miR-4458	CLIP-seq
MIRT989416	hsa-miR-4490	CLIP-seq
MIRT989417	hsa-miR-4500	CLIP-seq
MIRT989418	hsa-miR-4639-3p	CLIP-seq
MIRT989419	hsa-miR-4658	CLIP-seq
MIRT989420	hsa-miR-4678	CLIP-seq
MIRT989421	hsa-miR-4720-3p	CLIP-seq
MIRT989422	hsa-miR-4728-3p	CLIP-seq
MIRT989423	hsa-miR-4755-5p	CLIP-seq
MIRT989424	hsa-miR-4774-3p	CLIP-seq
MIRT989425	hsa-miR-4774-5p	CLIP-seq
MIRT989426	hsa-miR-4793-3p	CLIP-seq
MIRT989427	hsa-miR-4804-3p	CLIP-seq
MIRT989428	hsa-miR-496	CLIP-seq
MIRT989429	hsa-miR-518a-5p	CLIP-seq
MIRT989430	hsa-miR-527	CLIP-seq
MIRT989431	hsa-miR-545	CLIP-seq
MIRT989432	hsa-miR-548p	CLIP-seq
MIRT989433	hsa-miR-574-5p	CLIP-seq
MIRT989434	hsa-miR-579	CLIP-seq
MIRT989435	hsa-miR-581	CLIP-seq
MIRT989436	hsa-miR-616	CLIP-seq
MIRT989437	hsa-miR-623	CLIP-seq
MIRT989438	hsa-miR-625	CLIP-seq
MIRT989439	hsa-miR-637	CLIP-seq
MIRT989440	hsa-miR-642b	CLIP-seq
MIRT989441	hsa-miR-653	CLIP-seq
MIRT989442	hsa-miR-655	CLIP-seq
MIRT989443	hsa-miR-661	CLIP-seq
MIRT989444	hsa-miR-874	CLIP-seq
MIRT989445	hsa-miR-875-3p	CLIP-seq
MIRT989446	hsa-miR-92a	CLIP-seq
MIRT989447	hsa-miR-92b	CLIP-seq
MIRT989448	hsa-miR-96	CLIP-seq
MIRT989449	hsa-miR-98	CLIP-seq
MIRT989381	hsa-miR-1254	CLIP-seq
MIRT1993209	hsa-miR-186	CLIP-seq
MIRT989394	hsa-miR-3116	CLIP-seq
MIRT989395	hsa-miR-3117-5p	CLIP-seq
MIRT1993210	hsa-miR-3123	CLIP-seq
MIRT1993211	hsa-miR-3133	CLIP-seq
MIRT989400	hsa-miR-3163	CLIP-seq
MIRT1993212	hsa-miR-3169	CLIP-seq
MIRT1993213	hsa-miR-361-3p	CLIP-seq
MIRT1993214	hsa-miR-3622a-5p	CLIP-seq
MIRT1993215	hsa-miR-3689d	CLIP-seq
MIRT1993216	hsa-miR-3925-5p	CLIP-seq
MIRT1993217	hsa-miR-4269	CLIP-seq
MIRT989412	hsa-miR-4307	CLIP-seq
MIRT1993218	hsa-miR-4515	CLIP-seq
MIRT1993219	hsa-miR-4661-5p	CLIP-seq
MIRT1993220	hsa-miR-4709-3p	CLIP-seq
MIRT1993221	hsa-miR-4744	CLIP-seq
MIRT1993222	hsa-miR-4755-3p	CLIP-seq
MIRT1993223	hsa-miR-4773	CLIP-seq
MIRT989428	hsa-miR-496	CLIP-seq
MIRT1993224	hsa-miR-552	CLIP-seq
MIRT989433	hsa-miR-574-5p	CLIP-seq
MIRT989438	hsa-miR-625	CLIP-seq
MIRT989439	hsa-miR-637	CLIP-seq
MIRT989443	hsa-miR-661	CLIP-seq
MIRT2227077	hsa-miR-103a	CLIP-seq
MIRT2227078	hsa-miR-107	CLIP-seq
MIRT989379	hsa-miR-1206	CLIP-seq
MIRT989380	hsa-miR-1243	CLIP-seq
MIRT989381	hsa-miR-1254	CLIP-seq
MIRT989385	hsa-miR-1298	CLIP-seq
MIRT2227079	hsa-miR-1307	CLIP-seq
MIRT989386	hsa-miR-1324	CLIP-seq
MIRT1993209	hsa-miR-186	CLIP-seq
MIRT2227080	hsa-miR-2053	CLIP-seq
MIRT989393	hsa-miR-25	CLIP-seq
MIRT989394	hsa-miR-3116	CLIP-seq
MIRT989395	hsa-miR-3117-5p	CLIP-seq
MIRT989396	hsa-miR-3120-3p	CLIP-seq
MIRT1993211	hsa-miR-3133	CLIP-seq
MIRT989400	hsa-miR-3163	CLIP-seq
MIRT1993212	hsa-miR-3169	CLIP-seq
MIRT989402	hsa-miR-32	CLIP-seq
MIRT989403	hsa-miR-339-5p	CLIP-seq
MIRT989404	hsa-miR-3591-3p	CLIP-seq
MIRT1993213	hsa-miR-361-3p	CLIP-seq
MIRT1993214	hsa-miR-3622a-5p	CLIP-seq
MIRT989405	hsa-miR-363	CLIP-seq
MIRT2227081	hsa-miR-3647-3p	CLIP-seq
MIRT2227082	hsa-miR-3662	CLIP-seq
MIRT989408	hsa-miR-367	CLIP-seq
MIRT1993215	hsa-miR-3689d	CLIP-seq
MIRT989409	hsa-miR-374c	CLIP-seq
MIRT2227083	hsa-miR-3934	CLIP-seq
MIRT2227084	hsa-miR-3942-3p	CLIP-seq
MIRT1993217	hsa-miR-4269	CLIP-seq
MIRT2227085	hsa-miR-4300	CLIP-seq
MIRT989412	hsa-miR-4307	CLIP-seq
MIRT2227086	hsa-miR-4325	CLIP-seq
MIRT2227087	hsa-miR-4504	CLIP-seq
MIRT1993218	hsa-miR-4515	CLIP-seq
MIRT2227088	hsa-miR-455-3p	CLIP-seq
MIRT2227089	hsa-miR-4638-5p	CLIP-seq
MIRT2227090	hsa-miR-4645-3p	CLIP-seq
MIRT1993219	hsa-miR-4661-5p	CLIP-seq
MIRT989420	hsa-miR-4678	CLIP-seq
MIRT2227091	hsa-miR-4694-5p	CLIP-seq
MIRT2227092	hsa-miR-4695-3p	CLIP-seq
MIRT2227093	hsa-miR-4700-3p	CLIP-seq
MIRT1993220	hsa-miR-4709-3p	CLIP-seq
MIRT989421	hsa-miR-4720-3p	CLIP-seq
MIRT1993221	hsa-miR-4744	CLIP-seq
MIRT1993222	hsa-miR-4755-3p	CLIP-seq
MIRT1993223	hsa-miR-4773	CLIP-seq
MIRT2227094	hsa-miR-4775	CLIP-seq
MIRT2227095	hsa-miR-4795-3p	CLIP-seq
MIRT989427	hsa-miR-4804-3p	CLIP-seq
MIRT989428	hsa-miR-496	CLIP-seq
MIRT2227096	hsa-miR-513a-5p	CLIP-seq
MIRT2227097	hsa-miR-542-3p	CLIP-seq
MIRT989431	hsa-miR-545	CLIP-seq
MIRT989432	hsa-miR-548p	CLIP-seq
MIRT1993224	hsa-miR-552	CLIP-seq
MIRT2227098	hsa-miR-569	CLIP-seq
MIRT989434	hsa-miR-579	CLIP-seq
MIRT2227099	hsa-miR-590-3p	CLIP-seq
MIRT989438	hsa-miR-625	CLIP-seq
MIRT989439	hsa-miR-637	CLIP-seq
MIRT989440	hsa-miR-642b	CLIP-seq
MIRT989442	hsa-miR-655	CLIP-seq
MIRT989443	hsa-miR-661	CLIP-seq
MIRT2227100	hsa-miR-920	CLIP-seq
MIRT989446	hsa-miR-92a	CLIP-seq
MIRT989447	hsa-miR-92b	CLIP-seq
MIRT989379	hsa-miR-1206	CLIP-seq
MIRT989381	hsa-miR-1254	CLIP-seq
MIRT989385	hsa-miR-1298	CLIP-seq
MIRT1993209	hsa-miR-186	CLIP-seq
MIRT989394	hsa-miR-3116	CLIP-seq
MIRT989395	hsa-miR-3117-5p	CLIP-seq
MIRT1993211	hsa-miR-3133	CLIP-seq
MIRT1993212	hsa-miR-3169	CLIP-seq
MIRT1993213	hsa-miR-361-3p	CLIP-seq
MIRT1993215	hsa-miR-3689d	CLIP-seq
MIRT2227083	hsa-miR-3934	CLIP-seq
MIRT2227085	hsa-miR-4300	CLIP-seq
MIRT1993218	hsa-miR-4515	CLIP-seq
MIRT1993219	hsa-miR-4661-5p	CLIP-seq
MIRT1993221	hsa-miR-4744	CLIP-seq
MIRT1993222	hsa-miR-4755-3p	CLIP-seq
MIRT1993223	hsa-miR-4773	CLIP-seq
MIRT989428	hsa-miR-496	CLIP-seq
MIRT989438	hsa-miR-625	CLIP-seq
MIRT989439	hsa-miR-637	CLIP-seq
MIRT989443	hsa-miR-661	CLIP-seq
MIRT2227100	hsa-miR-920	CLIP-seq
MIRT989381	hsa-miR-1254	CLIP-seq
MIRT2530898	hsa-miR-1282	CLIP-seq
MIRT2530899	hsa-miR-1286	CLIP-seq
MIRT989386	hsa-miR-1324	CLIP-seq
MIRT2530900	hsa-miR-140-3p	CLIP-seq
MIRT2530901	hsa-miR-1468	CLIP-seq
MIRT2530902	hsa-miR-28-3p	CLIP-seq
MIRT989394	hsa-miR-3116	CLIP-seq
MIRT989395	hsa-miR-3117-5p	CLIP-seq
MIRT989396	hsa-miR-3120-3p	CLIP-seq
MIRT1993210	hsa-miR-3123	CLIP-seq
MIRT2530903	hsa-miR-3155	CLIP-seq
MIRT2530904	hsa-miR-3155b	CLIP-seq
MIRT989400	hsa-miR-3163	CLIP-seq
MIRT2530905	hsa-miR-3180-5p	CLIP-seq
MIRT989404	hsa-miR-3591-3p	CLIP-seq
MIRT1993214	hsa-miR-3622a-5p	CLIP-seq
MIRT1993216	hsa-miR-3925-5p	CLIP-seq
MIRT2530906	hsa-miR-4267	CLIP-seq
MIRT989412	hsa-miR-4307	CLIP-seq
MIRT2530907	hsa-miR-4459	CLIP-seq
MIRT2530908	hsa-miR-450b-5p	CLIP-seq
MIRT1993220	hsa-miR-4709-3p	CLIP-seq
MIRT2530909	hsa-miR-4722-5p	CLIP-seq
MIRT2530910	hsa-miR-484	CLIP-seq
MIRT989428	hsa-miR-496	CLIP-seq
MIRT989431	hsa-miR-545	CLIP-seq
MIRT989432	hsa-miR-548p	CLIP-seq
MIRT2530911	hsa-miR-607	CLIP-seq
MIRT989438	hsa-miR-625	CLIP-seq
MIRT989439	hsa-miR-637	CLIP-seq
MIRT989440	hsa-miR-642b	CLIP-seq
MIRT989443	hsa-miR-661	CLIP-seq
MIRT2680771	hsa-miR-1185	CLIP-seq
MIRT989381	hsa-miR-1254	CLIP-seq
MIRT2530898	hsa-miR-1282	CLIP-seq
MIRT2530899	hsa-miR-1286	CLIP-seq
MIRT989386	hsa-miR-1324	CLIP-seq
MIRT2530900	hsa-miR-140-3p	CLIP-seq
MIRT2530901	hsa-miR-1468	CLIP-seq
MIRT2530902	hsa-miR-28-3p	CLIP-seq
MIRT989394	hsa-miR-3116	CLIP-seq
MIRT989395	hsa-miR-3117-5p	CLIP-seq
MIRT989396	hsa-miR-3120-3p	CLIP-seq
MIRT1993210	hsa-miR-3123	CLIP-seq
MIRT2530903	hsa-miR-3155	CLIP-seq
MIRT2530904	hsa-miR-3155b	CLIP-seq
MIRT989400	hsa-miR-3163	CLIP-seq
MIRT2530905	hsa-miR-3180-5p	CLIP-seq
MIRT989404	hsa-miR-3591-3p	CLIP-seq
MIRT1993214	hsa-miR-3622a-5p	CLIP-seq
MIRT2680772	hsa-miR-3679-5p	CLIP-seq
MIRT2680773	hsa-miR-376a	CLIP-seq
MIRT2680774	hsa-miR-376b	CLIP-seq
MIRT1993216	hsa-miR-3925-5p	CLIP-seq
MIRT2530906	hsa-miR-4267	CLIP-seq
MIRT1993217	hsa-miR-4269	CLIP-seq
MIRT989412	hsa-miR-4307	CLIP-seq
MIRT2530907	hsa-miR-4459	CLIP-seq
MIRT2680775	hsa-miR-4473	CLIP-seq
MIRT2530908	hsa-miR-450b-5p	CLIP-seq
MIRT2680776	hsa-miR-4652-5p	CLIP-seq
MIRT1993220	hsa-miR-4709-3p	CLIP-seq
MIRT2530909	hsa-miR-4722-5p	CLIP-seq
MIRT2227095	hsa-miR-4795-3p	CLIP-seq
MIRT2530910	hsa-miR-484	CLIP-seq
MIRT989428	hsa-miR-496	CLIP-seq
MIRT2680777	hsa-miR-512-3p	CLIP-seq
MIRT2680778	hsa-miR-520f	CLIP-seq
MIRT989431	hsa-miR-545	CLIP-seq
MIRT989432	hsa-miR-548p	CLIP-seq
MIRT1993224	hsa-miR-552	CLIP-seq
MIRT2530911	hsa-miR-607	CLIP-seq
MIRT989438	hsa-miR-625	CLIP-seq
MIRT989439	hsa-miR-637	CLIP-seq
MIRT989440	hsa-miR-642b	CLIP-seq
MIRT989443	hsa-miR-661	CLIP-seq
MIRT2680779	hsa-miR-764	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	ISS
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS	9425278
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	TAS	9425278
GO:0005886	Component	Plasma membrane	IEA
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IEA
GO:0007416	Process	Synapse assembly	IEA
GO:0007416	Process	Synapse assembly	ISS
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0016020	Component	Membrane	IEA
GO:0016601	Process	Rac protein signal transduction	IEA
GO:0030175	Component	Filopodium	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031267	Function	Small GTPase binding	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0045202	Component	Synapse	IEA
GO:0048813	Process	Dendrite morphogenesis	IEA
GO:0048813	Process	Dendrite morphogenesis	ISS
GO:0098890	Component	Extrinsic component of postsynaptic membrane	IEA
GO:0098942	Process	Retrograde trans-synaptic signaling by trans-synaptic protein complex	IEA
GO:0098974	Process	Postsynaptic actin cytoskeleton organization	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1904395	Process	Positive regulation of skeletal muscle acetylcholine-gated channel clustering	IEA
GO:1905606	Process	Regulation of presynapse assembly	IEA

MIM	HGNC	e!Ensembl
602654	3591	ENSG00000152767

Q9Y4F1

Protein name

FERM, ARHGEF and pleckstrin domain-containing protein 1 (Chondrocyte-derived ezrin-like protein) (FERM, RhoGEF and pleckstrin domain-containing protein 1) (Pleckstrin homology domain-containing family C member 2) (PH domain-containing family C member 2)

Protein function

Functions as a guanine nucleotide exchange factor for RAC1. May play a role in semaphorin signaling. Plays a role in the assembly and disassembly of dendritic filopodia, the formation of dendritic spines, regulation of dendrite length and ultima

PDB

4H6Y

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09379	FERM_N	44 → 107	FERM N-terminal domain	Domain
PF00373	FERM_M	123 → 230	FERM central domain	Domain
PF09380	FERM_C	234 → 324	FERM C-terminal PH-like domain	Domain
PF08736	FA	329 → 372	FERM adjacent (FA)	Family
PF00621	RhoGEF	544 → 728	RhoGEF domain	Domain
PF00169	PH	760 → 856	PH domain	Domain
PF00169	PH	933 → 1029	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in cAMP-treated chondrocytes, but not in untreated chondrocytes. Detected in fetal brain, heart and spleen, and in adult testis, kidney and lung. {ECO:0000269|PubMed:9425278}.

Sequence

MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPQRA
PGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEALDREHL
AKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAG
EPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHL
SELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDK
AYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDAMPEALKSLIFPNFEPLHKFHTNFLK
EIEQRLALWEGRSNAQIRDYQRIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRR
LENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEI
TEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGREFIRLGSLSKLSGKGLQQRMFF
LFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASS
RSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKSPDEATAADQESEDDLSASRTSL
ERQAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFC
LFFYKSHQDNHPLASLPLLGYSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFERW
MEVIRSATSSASRPHVLSHKESLVY

Sequence length

1045

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (55)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BELL'S PALSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LARGE ARTERY STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC FEVER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMOOTH SURFACE DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	26911374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	26830138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	32588496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	25586835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31021836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34731623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31021836		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31021836		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma	Pheochromocytoma	BEFREE	26911374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

FARP1 (FERM, ARH/RhoGEF and pleckstrin domain protein 1)