Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10155
Gene name	Tripartite motif containing 28
Gene symbol	TRIM28
Synonyms (NCBI Gene)	KAP1PPP1R157RNF96TF1BTIF1BTIF1beta
Chromosome	19
Chromosome location	19q13.43
Summary	The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromati

161

Show/Hide all (161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052068	hsa-let-7b-5p	CLASH	23622248
MIRT051347	hsa-miR-15a-5p	CLASH	23622248
MIRT049953	hsa-miR-30a-5p	CLASH	23622248
MIRT049122	hsa-miR-92a-3p	CLASH	23622248
MIRT047101	hsa-miR-183-5p	CLASH	23622248
MIRT046915	hsa-miR-221-3p	CLASH	23622248
MIRT045571	hsa-miR-149-5p	CLASH	23622248
MIRT041711	hsa-miR-484	CLASH	23622248
MIRT041271	hsa-miR-193b-3p	CLASH	23622248
MIRT041001	hsa-miR-505-3p	CLASH	23622248
MIRT038878	hsa-miR-93-3p	CLASH	23622248
MIRT038141	hsa-miR-423-5p	CLASH	23622248
MIRT037943	hsa-miR-505-5p	CLASH	23622248
MIRT037599	hsa-miR-744-5p	CLASH	23622248
MIRT037068	hsa-miR-877-3p	CLASH	23622248
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	23592263
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	23592263
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT465279	hsa-miR-4481	PAR-CLIP	23592263
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT465277	hsa-miR-4450	PAR-CLIP	23592263
MIRT465276	hsa-miR-342-5p	PAR-CLIP	23592263
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	23592263
MIRT465274	hsa-miR-4651	PAR-CLIP	23592263
MIRT465273	hsa-miR-608	PAR-CLIP	23592263
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT465271	hsa-miR-542-3p	PAR-CLIP	23592263
MIRT465270	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	23592263
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	23592263
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	23592263
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	26701625
MIRT465276	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT465276	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT465276	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT465276	hsa-miR-342-5p	PAR-CLIP	26701625
MIRT465277	hsa-miR-4450	PAR-CLIP	26701625
MIRT465277	hsa-miR-4450	PAR-CLIP	26701625
MIRT465277	hsa-miR-4450	PAR-CLIP	26701625
MIRT465277	hsa-miR-4450	PAR-CLIP	26701625
MIRT465279	hsa-miR-4481	PAR-CLIP	26701625
MIRT465279	hsa-miR-4481	PAR-CLIP	26701625
MIRT465279	hsa-miR-4481	PAR-CLIP	26701625
MIRT465279	hsa-miR-4481	PAR-CLIP	26701625
MIRT465274	hsa-miR-4651	PAR-CLIP	26701625
MIRT465274	hsa-miR-4651	PAR-CLIP	26701625
MIRT465274	hsa-miR-4651	PAR-CLIP	26701625
MIRT465274	hsa-miR-4651	PAR-CLIP	26701625
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	26701625
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	26701625
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	26701625
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	26701625
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	26701625
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	26701625
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	26701625
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	26701625
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	26701625
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	26701625
MIRT465270	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT465270	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT465270	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT465270	hsa-miR-491-5p	PAR-CLIP	26701625
MIRT465271	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT465271	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT465271	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT465271	hsa-miR-542-3p	PAR-CLIP	26701625
MIRT465273	hsa-miR-608	PAR-CLIP	26701625
MIRT465273	hsa-miR-608	PAR-CLIP	26701625
MIRT465273	hsa-miR-608	PAR-CLIP	26701625
MIRT465273	hsa-miR-608	PAR-CLIP	26701625
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	26701625
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	26701625
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	26701625
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	26701625
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	26701625
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	26701625
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	26701625
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	26701625
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	26701625
MIRT465284	hsa-miR-4700-3p	PAR-CLIP	23592263
MIRT465282	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT465283	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT465280	hsa-miR-6890-5p	PAR-CLIP	23592263
MIRT465281	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT465279	hsa-miR-4481	PAR-CLIP	23592263
MIRT465278	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT465277	hsa-miR-4450	PAR-CLIP	23592263
MIRT465276	hsa-miR-342-5p	PAR-CLIP	23592263
MIRT465275	hsa-miR-4664-5p	PAR-CLIP	23592263
MIRT465274	hsa-miR-4651	PAR-CLIP	23592263
MIRT465273	hsa-miR-608	PAR-CLIP	23592263
MIRT465272	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT465271	hsa-miR-542-3p	PAR-CLIP	23592263
MIRT465270	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT465269	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT465268	hsa-miR-6737-5p	PAR-CLIP	23592263
MIRT465267	hsa-miR-6812-5p	PAR-CLIP	23592263
MIRT465266	hsa-miR-6819-5p	PAR-CLIP	23592263
MIRT1453734	hsa-miR-1275	CLIP-seq
MIRT1453735	hsa-miR-3187-3p	CLIP-seq
MIRT1453736	hsa-miR-3675-5p	CLIP-seq
MIRT1453737	hsa-miR-3915	CLIP-seq
MIRT1453738	hsa-miR-3928	CLIP-seq
MIRT1453739	hsa-miR-4488	CLIP-seq
MIRT1453740	hsa-miR-4525	CLIP-seq
MIRT1453741	hsa-miR-4529-5p	CLIP-seq
MIRT1453742	hsa-miR-4665-5p	CLIP-seq
MIRT1453743	hsa-miR-4697-5p	CLIP-seq
MIRT1453744	hsa-miR-4723-5p	CLIP-seq
MIRT1453745	hsa-miR-548aa	CLIP-seq
MIRT1453746	hsa-miR-548ac	CLIP-seq
MIRT1453747	hsa-miR-548ae	CLIP-seq
MIRT1453748	hsa-miR-548aj	CLIP-seq
MIRT1453749	hsa-miR-548am	CLIP-seq
MIRT1453750	hsa-miR-548d-3p	CLIP-seq
MIRT1453751	hsa-miR-548x	CLIP-seq
MIRT1453752	hsa-miR-548z	CLIP-seq
MIRT1453753	hsa-miR-605	CLIP-seq
MIRT1453754	hsa-miR-625	CLIP-seq
MIRT1453755	hsa-miR-637	CLIP-seq
MIRT1453735	hsa-miR-3187-3p	CLIP-seq
MIRT1453736	hsa-miR-3675-5p	CLIP-seq
MIRT1453741	hsa-miR-4529-5p	CLIP-seq
MIRT1453734	hsa-miR-1275	CLIP-seq
MIRT1453736	hsa-miR-3675-5p	CLIP-seq
MIRT1453740	hsa-miR-4525	CLIP-seq
MIRT1453742	hsa-miR-4665-5p	CLIP-seq
MIRT1453744	hsa-miR-4723-5p	CLIP-seq
MIRT1453754	hsa-miR-625	CLIP-seq
MIRT1453755	hsa-miR-637	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ZNF350	Unknown	22975076

Show/Hide all (77)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IEA
GO:0000791	Component	Euchromatin	IEA
GO:0000792	Component	Heterochromatin	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS
GO:0003677	Function	DNA binding	IDA	9016654
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IDA	27029610
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	ISS
GO:0003714	Function	Transcription corepressor activity	IDA	8769649
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0004672	Function	Protein kinase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	18082607
GO:0005515	Function	Protein binding	IPI	9016654, 10330177, 11013263, 16169070, 17512541, 17704056, 18060868, 18675275, 18854139, 19498464, 20424263, 20562864, 20858735, 20864041, 20936779, 21170338, 21277283, 21549307, 21642969, 21888893, 22975076, 22995936, 23034801, 23543754, 23665872, 24018422, 24657165, 24981860, 2649
GO:0005634	Component	Nucleus	IDA	8769649, 9016654, 25593309
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006281	Process	DNA repair	IDA	17178852
GO:0006325	Process	Chromatin organization	IBA
GO:0006325	Process	Chromatin organization	IEA
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	IEA
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	IMP	24623306
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	ISS
GO:0007566	Process	Embryo implantation	IEA
GO:0008270	Function	Zinc ion binding	IDA	10653693, 11226167
GO:0008270	Function	Zinc ion binding	IEA
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016925	Process	Protein sumoylation	IBA
GO:0016925	Process	Protein sumoylation	IDA	18082607
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	TAS
GO:0019789	Function	SUMO transferase activity	EXP	17298944
GO:0019789	Function	SUMO transferase activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	18082607
GO:0032991	Component	Protein-containing complex	IDA	17512541
GO:0032991	Component	Protein-containing complex	IEA
GO:0035851	Function	Krueppel-associated box domain binding	IDA	17512541, 23665872
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	23665872
GO:0043045	Process	Epigenetic programming of gene expression	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	36354136
GO:0044790	Process	Suppression of viral release by host	IDA	18248090
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	18248090
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045739	Process	Positive regulation of DNA repair	IDA	17178852
GO:0045869	Process	Negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9016654
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045935	Process	Positive regulation of nucleobase-containing compound metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060028	Process	Convergent extension involved in axis elongation	IEA
GO:0060669	Process	Embryonic placenta morphogenesis	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IMP	36354136
GO:0061659	Function	Ubiquitin-like protein ligase activity	IEA
GO:0070087	Function	Chromo shadow domain binding	IPI	15882967
GO:0071514	Process	Genomic imprinting	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	ISS
GO:1990841	Function	Promoter-specific chromatin binding	IDA	24623306

MIM	HGNC	e!Ensembl
601742	16384	ENSG00000130726

Q13263

Protein name

Transcription intermediary factor 1-beta (TIF1-beta) (E3 SUMO-protein ligase TRIM28) (EC 2.3.2.27) (KRAB-associated protein 1) (KAP-1) (KRAB-interacting protein 1) (KRIP-1) (Nuclear corepressor KAP-1) (RING finger protein 96) (RING-type E3 ubiquitin trans

Protein function

Nuclear corepressor for KRAB domain-containing zinc finger proteins (KRAB-ZFPs). Mediates gene silencing by recruiting CHD3, a subunit of the nucleosome remodeling and deacetylation (NuRD) complex, and SETDB1 (which specifically methylates histo

PDB

1FP0 , 2RO1 , 2YVR , 6H3A , 6I9H , 6QAJ , 6QU1 , 7Z36

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14634	zf-RING_5	64 → 122	zinc-RING finger domain	Domain
PF00643	zf-B_box	148 → 195	B-box zinc finger	Domain
PF00643	zf-B_box	204 → 245	B-box zinc finger	Domain
PF00628	PHD	627 → 672	PHD-finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues tested including spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. {ECO:0000269|PubMed:9016654}.

Sequence

MAASAAAASAAAASAASGSPGPGEGSAGGEKRSTAPSAAASASASAAASSPAGGGAEALE
LLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVC
KQQCFSKDIVENYFMRDSGSKAATDAQDANQCCTSCEDNAPATSYCVECSEPLCETCVEA
HQRVKYTKDHTVRSTGPAKSRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDH
QYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAIL
QIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWALESDNNTA
LLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGP
APMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSG
LMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQPGTAPAG
TPGAPPLAGMAIVKEEETEAAIGAPPTATEGPETKPVLMALAEGPGAEGPRLASPSGSTS
SGLEVVAPEGTSAPGGGPGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVP
GEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPL
HQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKA
DVQSIIGLQRFFETRMNEAFGDTKFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP

Sequence length

835

Interactions

View interactions

	Reactome
			Generic Transcription Pathway SUMOylation of transcription cofactors HCMV Early Events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Nephroblastoma	Pathogenic	rs2053798835	RCV001249584	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Predisposition to Wilms tumor	Pathogenic	rs2122629233	RCV002254854	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD KIDNEY WILMS TUMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial colorectal cancer	not provided	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIM28-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wilms tumor 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (94)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23060449, 24983967, 28498400, 29127420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	30120913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30543698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31351049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31351049		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	31351049		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	32725144	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	35682642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29651155		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29115614, 29569972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	26476730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23060449, 23991171, 25421577, 27412325, 27845900, 28068325, 28381187, 28454449, 30881504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27412325, 28068325, 31253870, 35031618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	28249048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38058023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30309319, 33589597, 35142083, 36238495, 36354136, 37870748, 40234915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	32156811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22959342, 23060449, 24983967, 29917268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25548895	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30484263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25548895, 28895414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	19898899		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23991171, 29393469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	23991171, 29393469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28864417, 29631612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28864417, 29631612	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	30510241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	BEFREE	30120913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31919284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	35682642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25548895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30484263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27905892, 28498803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30655676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26476730, 27905892, 30655676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26476730, 27905892, 30349292, 30655676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27905892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	34823491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	30543698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	27845900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24278015	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24696491, 33398366, 35031618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	37438603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	24741090, 25995248		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29407374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27095111, 28394358, 30309319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	27095111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23060449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24983967, 28592245, 37748077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30484263	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	30349292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23060449, 23991171, 25421577, 27412325, 27845900, 28068325, 28381187, 28454449, 30881504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22959342, 23060449, 24983967, 29917268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25548895, 28895414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24861921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27780869, 30479348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19898899, 23548070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18675275, 24983967, 26476730, 27412325, 27845900, 28394358, 28851455, 28895414, 30309319, 30349292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23991171, 29393469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27845900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30042493, 30309319, 36341538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36992419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31320749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23060449, 23096706, 23991171, 24983967, 25421577, 25548895, 25882849, 26212333, 26476730, 27095111, 27845900, 28381187, 29393469, 29569972, 29631612 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	29912901, 30694527		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nephroblastoma	Nephroblastoma	ORPHANET_DG	29912901		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nephroblastoma	Nephroblastoma	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nephroblastoma	Nephroblastoma	GENOMICS_ENGLAND_DG	30885698		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nephroblastoma	Nephroblastoma	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28498400, 29115614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26824653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28068325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	28895414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	25510701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25548895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25548895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24861921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27780869, 30479348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27780869, 28592290, 30479348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	23740979, 24696491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30484263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19898899, 23548070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37443302, 38058023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35549637	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34518220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	30484263	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23991171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	32725144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	29912901, 30543698, 32699065, 37792584, 38110397, 40340749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM28 (tripartite motif containing 28)