CEBPZ (CCAAT enhancer binding protein zeta)

Gene

• Entrez ID: 10153
• Gene name: CCAAT enhancer binding protein zeta
• Gene symbol: CEBPZ
• Synonyms (NCBI Gene): CBF, CBF2, HSP-CBF, NOC1
• Chromosome: 2
• Chromosome location: 2p22.2
• Summary: This gene belongs to the CBF/Mak21 family. The encoded protein plays a role in cellular response to environmental stimuli through a transcriptional process that involves heat shock factors, conserved DNA elements (heat shock elements or HSEs) and CCAAT bo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024044	hsa-miR-1-3p	Proteomics	18668040
MIRT2501483	hsa-miR-1	CLIP-seq
MIRT2501484	hsa-miR-1253	CLIP-seq
MIRT2501485	hsa-miR-1299	CLIP-seq
MIRT2501486	hsa-miR-206	CLIP-seq
MIRT2501487	hsa-miR-3120-3p	CLIP-seq
MIRT2501488	hsa-miR-3673	CLIP-seq
MIRT2501489	hsa-miR-3688-3p	CLIP-seq
MIRT2501490	hsa-miR-3919	CLIP-seq
MIRT2501491	hsa-miR-4756-3p	CLIP-seq
MIRT2501492	hsa-miR-545	CLIP-seq
MIRT2501493	hsa-miR-548p	CLIP-seq
MIRT2501494	hsa-miR-563	CLIP-seq
MIRT2501495	hsa-miR-576-3p	CLIP-seq
MIRT2501496	hsa-miR-613	CLIP-seq
MIRT2501497	hsa-miR-875-3p	CLIP-seq
MIRT2501483	hsa-miR-1	CLIP-seq
MIRT2501484	hsa-miR-1253	CLIP-seq
MIRT2501485	hsa-miR-1299	CLIP-seq
MIRT2501486	hsa-miR-206	CLIP-seq
MIRT2501487	hsa-miR-3120-3p	CLIP-seq
MIRT2677985	hsa-miR-3613-3p	CLIP-seq
MIRT2501488	hsa-miR-3673	CLIP-seq
MIRT2501489	hsa-miR-3688-3p	CLIP-seq
MIRT2501490	hsa-miR-3919	CLIP-seq
MIRT2501491	hsa-miR-4756-3p	CLIP-seq
MIRT2501492	hsa-miR-545	CLIP-seq
MIRT2501493	hsa-miR-548p	CLIP-seq
MIRT2501494	hsa-miR-563	CLIP-seq
MIRT2501495	hsa-miR-576-3p	CLIP-seq
MIRT2501496	hsa-miR-613	CLIP-seq
MIRT2501497	hsa-miR-875-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IDA	11306579
GO:0003713	Function	Transcription coactivator activity	IGI	11306579
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	21900206, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11306579
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	2247079
GO:0005654	Component	Nucleoplasm	IDA
GO:0016602	Component	CCAAT-binding factor complex	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	2247079, 11306579

Other IDs

• MIM: 612828
• HGNC: 24218
• e!Ensembl: ENSG00000115816

Protein

• UniProt ID: Q03701
• Protein name: CCAAT/enhancer-binding protein zeta (CCAAT-box-binding transcription factor) (CBF) (CCAAT-binding factor)
• Protein function: Stimulates transcription from the HSP70 promoter.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03914	CBF	523 → 731	CBF/Mak21 family	Family

• Sequence:

  MAAVKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSEAENGFSLEEVLRLGGTKQDYLMLAT
  LDENEEVIDGGKKGAIDDLQQGELEAFIQNLNLAKYTKASLVEEDEPAEKENSSKKEVKI
  PKINNKNTAESQRTSVNKVKNKNRPEPHSDENGSTTPKVKKDKQNIFEFFERQTLLLRPG
  GKWYDLEYSNEYSLKPQPQDVVSKYKTLAQKLYQHEINLFKSKTNSQKGASSTWMKAIVS
  SGTLGDRMAAMILLIQDDAVHTLQFVETLVNLVKKKGSKQQCLMALDTFKELLITDLLPD
  NRKLRIFSQRPFDKLEQLSSGNKDSRDRRLILWYFEHQLKHLVAEFVQVLETLSHDTLVT
  TKTRALTVAHELLCNKPEEEKALLVQVVNKLGDPQNRIATKASHLLETLLCKHPNMKGVV
  SGEVERLLFRSNISSKAQYYAICFLNQMALSHEESELANKLITVYFCFFRTCVKKKDVES
  KMLSALLTGVNRAYPYSQTGDDKVREQIDTLFKVLHIVNFNTSVQALMLLFQVMNSQQTI
  SDRYYTALYRKMLDPGLMTCSKQAMFLNLVYKSLKADIVLRRVKAFVKRLLQVTCQQMPP
  FICGALYLVSEILKAKPGLRSQLDDHPESDDEENFIDANDDEDMEKFTDADKETEIVKKL
  ETEETVPETDVETKKPEVASWVHFDNLKGGKQLNKYDPFSRNPLFCGAENTSLWELKKLS
  VHFHPSVALFAKTILQGNYIQYSGDPLQDFTLMRFLDRFVYRNPKPHKGKENTDSVVMQP
  KRKHFIKDIRHLPVNSKEFLAKEESQIPVDEVFFHRYYKKVAVKEKQKRDADEESIEDVD
  DEEFEELIDTFEDDNCFSSGKDDMDFAGNVKKRTKGAKDNTLDEDSEGSDDELGNLDDDE
  VSLGSMDDEEFAEVDEDGGTFMDVLDDESESVPELEVHSKVSTKKSKRKGTDDFDFAGSF
  QGPRKKKRNLNDSSLFVSAEEFGHLLDENMGSKFDNIGMNAMANKDNASLKQLRWEAERD
  DWLHNRDAKSIIKKKKHFKKKRIKTTQKTKKQRK

• Sequence length: 1054

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	BEFREE	30737833		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	19427034, 24449215, 26891877		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	14645432		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	25088818		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30309846		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30500413		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28507896, 30072368		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	9721943		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27317653, 28919535		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	26980726		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30105409		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	30467218		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	12511777, 30762468		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	28629320		★☆☆☆☆ Found in Text Mining only
Encephalomalacia	Encephalomalacia	BEFREE	29609518		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28729293, 30026384		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30026384		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	28729293		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperemia	Hyperemia	BEFREE	31063009		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27317653		★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	31283776		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30334644, 31079020		★☆☆☆☆ Found in Text Mining only
Intracranial Meningioma	Intracranial Meningioma	BEFREE	29153364		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30105409		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	14645432, 15621809, 16390318, 17145866, 21275954, 23636907, 25612891, 29249175, 8570222, 9192636, 9447846		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19908318, 24721792	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10882733, 17485551, 18981008, 19908318, 20425795, 20589720, 21928314, 22875911, 22886749, 24721792, 24923295, 25753065, 25932436, 26397705, 26771812, 26838606, 27798625, 29310020, 30117318, 30635631, 31171000, 31182436, 32092139, 33049054, 33208771, 33351131, 33597098, 34003250, 34010414, 34619758, 35788257, 36796022, 38062912, 8631821	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10084082, 11172539, 15156181, 16081693, 16643429, 19720919, 21076613, 21106240, 24319183, 24923295, 25612891, 26980726, 28299658, 29249175		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30792254		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30500413		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10972144		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	30635631	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	22145956		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	12511777, 30762468		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30467218, 31515217		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	28209582, 31601573		★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	28209582, 31601573		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	25748621		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28900832, 30066053, 30072368, 30618190		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14504408		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	14504408	Associate	★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	30467218		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30334644		★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	30792254		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	3673655		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	30026384		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	14613485		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31307289		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36553500	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	12500096, 27605019, 27906765, 29738805, 30213237		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11037881, 12881530, 14613485		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	2398939		★☆☆☆☆ Found in Text Mining only