CDH17 (cadherin 17)

Gene

• Entrez ID: 1015
• Gene name: Cadherin 17
• Gene symbol: CDH17
• Synonyms (NCBI Gene): CDH16, HPT-1, HPT1
• Chromosome: 8
• Chromosome location: 8q22.1
• Summary: This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT879716	hsa-miR-1206	CLIP-seq
MIRT879717	hsa-miR-1273	CLIP-seq
MIRT879718	hsa-miR-1276	CLIP-seq
MIRT879719	hsa-miR-140-5p	CLIP-seq
MIRT879720	hsa-miR-141	CLIP-seq
MIRT879721	hsa-miR-200a	CLIP-seq
MIRT879722	hsa-miR-200b	CLIP-seq
MIRT879723	hsa-miR-200c	CLIP-seq
MIRT879724	hsa-miR-2053	CLIP-seq
MIRT879725	hsa-miR-2682	CLIP-seq
MIRT879726	hsa-miR-3145-5p	CLIP-seq
MIRT879727	hsa-miR-3157-5p	CLIP-seq
MIRT879728	hsa-miR-3160-3p	CLIP-seq
MIRT879729	hsa-miR-3168	CLIP-seq
MIRT879730	hsa-miR-3614-5p	CLIP-seq
MIRT879731	hsa-miR-374c	CLIP-seq
MIRT879732	hsa-miR-3926	CLIP-seq
MIRT879733	hsa-miR-4277	CLIP-seq
MIRT879734	hsa-miR-429	CLIP-seq
MIRT879735	hsa-miR-4433	CLIP-seq
MIRT879736	hsa-miR-4459	CLIP-seq
MIRT879737	hsa-miR-4475	CLIP-seq
MIRT879738	hsa-miR-4486	CLIP-seq
MIRT879739	hsa-miR-4487	CLIP-seq
MIRT879740	hsa-miR-449c	CLIP-seq
MIRT879741	hsa-miR-450b-3p	CLIP-seq
MIRT879742	hsa-miR-4514	CLIP-seq
MIRT879743	hsa-miR-4645-5p	CLIP-seq
MIRT879744	hsa-miR-4649-5p	CLIP-seq
MIRT879745	hsa-miR-4668-5p	CLIP-seq
MIRT879746	hsa-miR-4673	CLIP-seq
MIRT879747	hsa-miR-4691-3p	CLIP-seq
MIRT879748	hsa-miR-4692	CLIP-seq
MIRT879749	hsa-miR-4694-3p	CLIP-seq
MIRT879750	hsa-miR-4695-5p	CLIP-seq
MIRT879751	hsa-miR-4712-3p	CLIP-seq
MIRT879752	hsa-miR-4713-3p	CLIP-seq
MIRT879753	hsa-miR-4742-3p	CLIP-seq
MIRT879754	hsa-miR-4768-3p	CLIP-seq
MIRT879755	hsa-miR-508-5p	CLIP-seq
MIRT879756	hsa-miR-522	CLIP-seq
MIRT879757	hsa-miR-548s	CLIP-seq
MIRT879758	hsa-miR-558	CLIP-seq
MIRT879759	hsa-miR-569	CLIP-seq
MIRT879760	hsa-miR-638	CLIP-seq
MIRT879761	hsa-miR-655	CLIP-seq
MIRT879762	hsa-miR-658	CLIP-seq
MIRT879763	hsa-miR-661	CLIP-seq
MIRT879764	hsa-miR-665	CLIP-seq
MIRT879765	hsa-miR-766	CLIP-seq
MIRT879766	hsa-miR-769-3p	CLIP-seq
MIRT879717	hsa-miR-1273	CLIP-seq
MIRT879726	hsa-miR-3145-5p	CLIP-seq
MIRT879728	hsa-miR-3160-3p	CLIP-seq
MIRT879732	hsa-miR-3926	CLIP-seq
MIRT879735	hsa-miR-4433	CLIP-seq
MIRT879736	hsa-miR-4459	CLIP-seq
MIRT879738	hsa-miR-4486	CLIP-seq
MIRT879739	hsa-miR-4487	CLIP-seq
MIRT879741	hsa-miR-450b-3p	CLIP-seq
MIRT2197342	hsa-miR-451b	CLIP-seq
MIRT879744	hsa-miR-4649-5p	CLIP-seq
MIRT879750	hsa-miR-4695-5p	CLIP-seq
MIRT2197343	hsa-miR-4696	CLIP-seq
MIRT879752	hsa-miR-4713-3p	CLIP-seq
MIRT879754	hsa-miR-4768-3p	CLIP-seq
MIRT879755	hsa-miR-508-5p	CLIP-seq
MIRT879757	hsa-miR-548s	CLIP-seq
MIRT879758	hsa-miR-558	CLIP-seq
MIRT879760	hsa-miR-638	CLIP-seq
MIRT879762	hsa-miR-658	CLIP-seq
MIRT879763	hsa-miR-661	CLIP-seq
MIRT879764	hsa-miR-665	CLIP-seq
MIRT879765	hsa-miR-766	CLIP-seq
MIRT879766	hsa-miR-769-3p	CLIP-seq
MIRT879717	hsa-miR-1273	CLIP-seq
MIRT2446665	hsa-miR-1285	CLIP-seq
MIRT879726	hsa-miR-3145-5p	CLIP-seq
MIRT2446666	hsa-miR-3187-5p	CLIP-seq
MIRT879738	hsa-miR-4486	CLIP-seq
MIRT879744	hsa-miR-4649-5p	CLIP-seq
MIRT879755	hsa-miR-508-5p	CLIP-seq
MIRT2446667	hsa-miR-548c-3p	CLIP-seq
MIRT2446668	hsa-miR-612	CLIP-seq
MIRT879763	hsa-miR-661	CLIP-seq
MIRT879765	hsa-miR-766	CLIP-seq
MIRT879717	hsa-miR-1273	CLIP-seq
MIRT2446665	hsa-miR-1285	CLIP-seq
MIRT879726	hsa-miR-3145-5p	CLIP-seq
MIRT2446666	hsa-miR-3187-5p	CLIP-seq
MIRT2500637	hsa-miR-323-5p	CLIP-seq
MIRT2500638	hsa-miR-3622b-5p	CLIP-seq
MIRT2500639	hsa-miR-3945	CLIP-seq
MIRT2500640	hsa-miR-4253	CLIP-seq
MIRT2500641	hsa-miR-4432	CLIP-seq
MIRT879738	hsa-miR-4486	CLIP-seq
MIRT2197342	hsa-miR-451b	CLIP-seq
MIRT879744	hsa-miR-4649-5p	CLIP-seq
MIRT2197343	hsa-miR-4696	CLIP-seq
MIRT879755	hsa-miR-508-5p	CLIP-seq
MIRT2500642	hsa-miR-541	CLIP-seq
MIRT2446667	hsa-miR-548c-3p	CLIP-seq
MIRT2446668	hsa-miR-612	CLIP-seq
MIRT2500643	hsa-miR-654-5p	CLIP-seq
MIRT879763	hsa-miR-661	CLIP-seq
MIRT879765	hsa-miR-766	CLIP-seq
MIRT2500644	hsa-miR-876-3p	CLIP-seq
MIRT879717	hsa-miR-1273	CLIP-seq
MIRT2446665	hsa-miR-1285	CLIP-seq
MIRT879726	hsa-miR-3145-5p	CLIP-seq
MIRT2446666	hsa-miR-3187-5p	CLIP-seq
MIRT2500637	hsa-miR-323-5p	CLIP-seq
MIRT2500638	hsa-miR-3622b-5p	CLIP-seq
MIRT2500639	hsa-miR-3945	CLIP-seq
MIRT2500640	hsa-miR-4253	CLIP-seq
MIRT2500641	hsa-miR-4432	CLIP-seq
MIRT879738	hsa-miR-4486	CLIP-seq
MIRT2197342	hsa-miR-451b	CLIP-seq
MIRT879744	hsa-miR-4649-5p	CLIP-seq
MIRT2197343	hsa-miR-4696	CLIP-seq
MIRT879755	hsa-miR-508-5p	CLIP-seq
MIRT2446667	hsa-miR-548c-3p	CLIP-seq
MIRT2446668	hsa-miR-612	CLIP-seq
MIRT879763	hsa-miR-661	CLIP-seq
MIRT879765	hsa-miR-766	CLIP-seq
MIRT2500644	hsa-miR-876-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CDX2	Activation	20568120
CDX2	Unknown	12404231;15732140
HNF1A	Activation	20568120

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IBA
GO:0002314	Process	Germinal center B cell differentiation	IEA
GO:0002315	Process	Marginal zone B cell differentiation	IEA
GO:0005178	Function	Integrin binding	IPI	25336636
GO:0005427	Function	Proton-dependent oligopeptide secondary active transmembrane transporter activity	IEA
GO:0005427	Function	Proton-dependent oligopeptide secondary active transmembrane transporter activity	ISS
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IBA
GO:0006857	Process	Oligopeptide transport	IEA
GO:0007043	Process	Cell-cell junction assembly	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	8153632
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	ISS
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	25336636
GO:0008013	Function	Beta-catenin binding	IBA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	15279905
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	ISS
GO:0016342	Component	Catenin complex	IBA
GO:0016477	Process	Cell migration	IBA
GO:0030054	Component	Cell junction	IDA
GO:0030183	Process	B cell differentiation	IEA
GO:0033626	Process	Positive regulation of integrin activation by cell surface receptor linked signal transduction	IMP	25336636
GO:0034332	Process	Adherens junction organization	IBA
GO:0035672	Process	Oligopeptide transmembrane transport	ISS
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IBA
GO:0045296	Function	Cadherin binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048536	Process	Spleen development	IEA
GO:0098609	Process	Cell-cell adhesion	IEA

Other IDs

• MIM: 603017
• HGNC: 1756
• e!Ensembl: ENSG00000079112

Protein

• UniProt ID: Q12864
• Protein name: Cadherin-17 (Intestinal peptide-associated transporter HPT-1) (Liver-intestine cadherin) (LI-cadherin)
• Protein function: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a rol
• PDB: 6ULM, 7CYM, 7EV1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00028	Cadherin	131 → 235	Cadherin domain	Domain
  PF00028	Cadherin	243 → 331	Cadherin domain	Domain
  PF00028	Cadherin	345 → 440	Cadherin domain	Domain
  PF00028	Cadherin	456 → 558	Cadherin domain	Domain
  PF00028	Cadherin	571 → 657	Cadherin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the gastrointestinal tract and pancreatic duct. Not detected in kidney, lung, liver, brain, adrenal gland and skin. {ECO:0000269|PubMed:8153632}.
• Sequence:

  MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTF
  ELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDIN
  DNRPTFLQSKYEGSVRQNSRPGKPFLYVNATDLDDPATPNGQLYYQIVIQLPMINNVMYF
  QINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWK
  APKPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDR
  EEKDAYVFYAVAKDEYGKPLSYPLEIHVKVKDINDNPPTCPSPVTVFEVQENERLGNSIG
  TLTAHDRDEENTANSFLNYRIVEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNL
  TIEVSDKDFKTLCFVQINVIDINDQIPIFEKSDYGNLTLAEDTNIGSTILTIQATDADEP
  FTGSSKILYHIIKGDSEGRLGVDTDPHTNTGYVIIKKPLDFETAAVSNIVFKAENPEPLV
  FGVKYNASSFAKFTLIVTDVNEAPQFSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISY
  SLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDV
  NDNPPRLAKDYTGLFFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSLGSGSLQNDWEVSK
  INGTHARLSTRHTEFEEREYVVLIRINDGGRPPLEGIVSLPVTFCSCVEGSCFRPAGHQT
  GIPTVGMAVGILLTTLLVIGIILAVVFIRIKKDKGKDNVESAQASEVKPLRS

• Sequence length: 832

Pathways

KEGG:

Gastric cancer

Reactome:

Adherens junctions interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	12824888, 18552820		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28029907, 28969003, 31605356		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	23053896		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	28969003		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29659895		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	9615235		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27846146		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	25918132		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	25918132	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Occupational	Asthma	CTD_human_DG	25918132		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	BEFREE	23053896, 28807490		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	29257318	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	16402135, 17938632		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	28197418		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33899544	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23053896	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19676131, 23554857		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19626651	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	24437456	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22810971	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15696118, 20670131, 20679884, 23196795, 35606285, 37558687	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15886705	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	40179422	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	16753598		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30047135		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28622054		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18552820, 24437456, 28029907, 38452580	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15732140, 20580775, 23326130, 30227326		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15279905, 17828401		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23326130, 24437456, 28029907, 30227326, 37081068, 38608841	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	30134108		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16753598		★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	18552820	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	22960999		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	15732140		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	28029907		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	16753598		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	26497854	Associate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	29659895		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	11413113, 20398667, 23053896, 28453457	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	24437456	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	16753598		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	15696118	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14623315, 15701831, 16951245, 19626651, 19676131, 20580775, 28442387, 28631187, 29387234		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15701831, 16951245		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28442387		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	23298905		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23326130, 37081068	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37899424	Inhibit	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	PSYGENET_DG	17938632		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	28197418		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19676131		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30189188, 31004701		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20500517, 22676223, 22791949, 23298905, 23554857, 24465527, 27580354, 27909714, 28387908, 28453457, 29203930, 29783070, 31095636, 31605356		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19676131, 20580775, 23554857, 27035870, 29084915, 29673969, 30047135		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21465190, 28622054		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28916526		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27807673		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	15178443, 15701831, 15732140, 16753598, 16951245, 19676131, 20500517, 20580775, 22791949, 23298905, 23326130, 23554857, 24465527, 24702883, 25336636, 27035870, 27909714, 28631187, 29203930, 29387234, 30047135, 30134108, 31004701		★☆☆☆☆ Found in Text Mining only
Neoplasms, Glandular and Epithelial	Neoplasm	LHGDN	17895753		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	25266742		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	16753598		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37558687, 38452580	Associate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	16753598		★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	LHGDN	17895753		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30189188, 31004701		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25307987	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	38452580	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	18552820	Associate	★☆☆☆☆ Found in Text Mining only
Pilomatrixoma	Pilomatrixoma	BEFREE	29369390		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	25266742		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16753598		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17895753		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	19676131		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	29296855		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20500517, 22676223, 22791949, 23298905, 23554857, 24465527, 27580354, 27909714, 28387908, 28453457, 29203930, 29783070, 31095636, 31605356		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18552820, 20398667, 22048633, 22676223, 23053896, 23089909, 26743780, 27580354, 28029907, 28387908, 28453457, 34364873	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	17914110, 37558687	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	37899424	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22028439, 22135066		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	37558687	Associate	★☆☆☆☆ Found in Text Mining only