CLEC3A (C-type lectin domain family 3 member A)

Gene

• Entrez ID: 10143
• Gene name: C-type lectin domain family 3 member A
• Gene symbol: CLEC3A
• Synonyms (NCBI Gene): CLECSF1
• Chromosome: 16
• Chromosome location: 16q23.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT896018	hsa-miR-1179	CLIP-seq
MIRT896019	hsa-miR-216a	CLIP-seq
MIRT896020	hsa-miR-219-1-3p	CLIP-seq
MIRT896021	hsa-miR-33a	CLIP-seq
MIRT896022	hsa-miR-33b	CLIP-seq
MIRT896023	hsa-miR-4318	CLIP-seq
MIRT896024	hsa-miR-4639-3p	CLIP-seq
MIRT896025	hsa-miR-4662a-3p	CLIP-seq
MIRT896026	hsa-miR-4693-5p	CLIP-seq
MIRT896027	hsa-miR-4765	CLIP-seq
MIRT896028	hsa-miR-571	CLIP-seq
MIRT896029	hsa-miR-892a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	TAS	10524194
GO:0001503	Process	Ossification	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	TAS	10524194

Other IDs

• MIM: 613588
• HGNC: 2052
• e!Ensembl: ENSG00000166509

Protein

• UniProt ID: O75596
• Protein name: C-type lectin domain family 3 member A (C-type lectin superfamily member 1) (Cartilage-derived C-type lectin)
• Protein function: Promotes cell adhesion to laminin-332 and fibronectin.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	84 → 193	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Restricted to cartilage and breast. Also expressed in breast cancers. {ECO:0000269|PubMed:19173304}.
• Sequence:

  MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKE
  IQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKR
  SLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSD
  EACRSSKRYICEFTIPQ

• Sequence length: 197

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	26621817		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29892197		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31983196, 35120331	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	26621817		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	26621817		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20060954, 30001809		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	GWASCAT_DG	26621817		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35409356	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32319617	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29892197		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	26621817		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29892197		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	26621817		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20060954	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32319617	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37391754	Stimulate	★☆☆☆☆ Found in Text Mining only