Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10139
Gene name	ARF related protein 1
Gene symbol	ARFRP1
Synonyms (NCBI Gene)	ARL18ARPArp1
Chromosome	20
Chromosome location	20q13.33
Summary	The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golg

166

Show/Hide all (166)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029524	hsa-miR-26b-5p	Microarray	19088304
MIRT793297	hsa-miR-103a	CLIP-seq
MIRT793298	hsa-miR-107	CLIP-seq
MIRT793299	hsa-miR-1225-3p	CLIP-seq
MIRT793300	hsa-miR-1226	CLIP-seq
MIRT793301	hsa-miR-125a-5p	CLIP-seq
MIRT793302	hsa-miR-125b	CLIP-seq
MIRT793303	hsa-miR-1294	CLIP-seq
MIRT793304	hsa-miR-15a	CLIP-seq
MIRT793305	hsa-miR-15b	CLIP-seq
MIRT793306	hsa-miR-16	CLIP-seq
MIRT793307	hsa-miR-185	CLIP-seq
MIRT793308	hsa-miR-1915	CLIP-seq
MIRT793309	hsa-miR-195	CLIP-seq
MIRT793310	hsa-miR-214	CLIP-seq
MIRT793311	hsa-miR-298	CLIP-seq
MIRT793312	hsa-miR-3121-3p	CLIP-seq
MIRT793313	hsa-miR-3180	CLIP-seq
MIRT793314	hsa-miR-3180-3p	CLIP-seq
MIRT793315	hsa-miR-3194-5p	CLIP-seq
MIRT793316	hsa-miR-3196	CLIP-seq
MIRT793317	hsa-miR-3202	CLIP-seq
MIRT793318	hsa-miR-330-3p	CLIP-seq
MIRT793319	hsa-miR-331-3p	CLIP-seq
MIRT793320	hsa-miR-3591-3p	CLIP-seq
MIRT793321	hsa-miR-361-3p	CLIP-seq
MIRT793322	hsa-miR-3619-5p	CLIP-seq
MIRT793323	hsa-miR-3622a-3p	CLIP-seq
MIRT793324	hsa-miR-3622b-3p	CLIP-seq
MIRT793325	hsa-miR-3663-3p	CLIP-seq
MIRT793326	hsa-miR-3675-5p	CLIP-seq
MIRT793327	hsa-miR-3918	CLIP-seq
MIRT793328	hsa-miR-3973	CLIP-seq
MIRT793329	hsa-miR-424	CLIP-seq
MIRT793330	hsa-miR-4254	CLIP-seq
MIRT793331	hsa-miR-4268	CLIP-seq
MIRT793332	hsa-miR-4287	CLIP-seq
MIRT793333	hsa-miR-4291	CLIP-seq
MIRT793334	hsa-miR-4293	CLIP-seq
MIRT793335	hsa-miR-4300	CLIP-seq
MIRT793336	hsa-miR-4306	CLIP-seq
MIRT793337	hsa-miR-4308	CLIP-seq
MIRT793338	hsa-miR-4319	CLIP-seq
MIRT793339	hsa-miR-4323	CLIP-seq
MIRT793340	hsa-miR-4436b-3p	CLIP-seq
MIRT793341	hsa-miR-4459	CLIP-seq
MIRT793342	hsa-miR-4468	CLIP-seq
MIRT793343	hsa-miR-4469	CLIP-seq
MIRT793344	hsa-miR-4512	CLIP-seq
MIRT793345	hsa-miR-4520a-3p	CLIP-seq
MIRT793346	hsa-miR-4530	CLIP-seq
MIRT793347	hsa-miR-4644	CLIP-seq
MIRT793348	hsa-miR-4652-5p	CLIP-seq
MIRT793349	hsa-miR-4660	CLIP-seq
MIRT793350	hsa-miR-4685-3p	CLIP-seq
MIRT793351	hsa-miR-4685-5p	CLIP-seq
MIRT793352	hsa-miR-4690-3p	CLIP-seq
MIRT793353	hsa-miR-4691-3p	CLIP-seq
MIRT793354	hsa-miR-4691-5p	CLIP-seq
MIRT793355	hsa-miR-4695-5p	CLIP-seq
MIRT793356	hsa-miR-4706	CLIP-seq
MIRT793357	hsa-miR-4710	CLIP-seq
MIRT793358	hsa-miR-4717-5p	CLIP-seq
MIRT793359	hsa-miR-4726-3p	CLIP-seq
MIRT793360	hsa-miR-4747-5p	CLIP-seq
MIRT793361	hsa-miR-4749-3p	CLIP-seq
MIRT793362	hsa-miR-4749-5p	CLIP-seq
MIRT793363	hsa-miR-4755-3p	CLIP-seq
MIRT793364	hsa-miR-4779	CLIP-seq
MIRT793365	hsa-miR-4786-3p	CLIP-seq
MIRT793366	hsa-miR-483-3p	CLIP-seq
MIRT793367	hsa-miR-497	CLIP-seq
MIRT793368	hsa-miR-513a-5p	CLIP-seq
MIRT793369	hsa-miR-548a-5p	CLIP-seq
MIRT793370	hsa-miR-548ab	CLIP-seq
MIRT793371	hsa-miR-548ak	CLIP-seq
MIRT793372	hsa-miR-548b-3p	CLIP-seq
MIRT793373	hsa-miR-548b-5p	CLIP-seq
MIRT793374	hsa-miR-548c-5p	CLIP-seq
MIRT793375	hsa-miR-548d-5p	CLIP-seq
MIRT793376	hsa-miR-548h	CLIP-seq
MIRT793377	hsa-miR-548i	CLIP-seq
MIRT793378	hsa-miR-548j	CLIP-seq
MIRT793379	hsa-miR-548w	CLIP-seq
MIRT793380	hsa-miR-548y	CLIP-seq
MIRT793381	hsa-miR-559	CLIP-seq
MIRT793382	hsa-miR-617	CLIP-seq
MIRT793383	hsa-miR-646	CLIP-seq
MIRT793384	hsa-miR-665	CLIP-seq
MIRT793385	hsa-miR-761	CLIP-seq
MIRT793386	hsa-miR-802	CLIP-seq
MIRT793387	hsa-miR-920	CLIP-seq
MIRT793388	hsa-miR-922	CLIP-seq
MIRT1545474	hsa-miR-4313	CLIP-seq
MIRT1934110	hsa-miR-3915	CLIP-seq
MIRT1934111	hsa-miR-3928	CLIP-seq
MIRT1934112	hsa-miR-4325	CLIP-seq
MIRT1934113	hsa-miR-4494	CLIP-seq
MIRT1934114	hsa-miR-4499	CLIP-seq
MIRT1934115	hsa-miR-450b-5p	CLIP-seq
MIRT793344	hsa-miR-4512	CLIP-seq
MIRT1934116	hsa-miR-507	CLIP-seq
MIRT1934117	hsa-miR-557	CLIP-seq
MIRT2173966	hsa-miR-146b-3p	CLIP-seq
MIRT2173967	hsa-miR-188-3p	CLIP-seq
MIRT2173968	hsa-miR-339-5p	CLIP-seq
MIRT2173969	hsa-miR-3679-3p	CLIP-seq
MIRT2173970	hsa-miR-3909	CLIP-seq
MIRT2173971	hsa-miR-4446-3p	CLIP-seq
MIRT2173972	hsa-miR-4449	CLIP-seq
MIRT2173973	hsa-miR-4650-5p	CLIP-seq
MIRT2173974	hsa-miR-4675	CLIP-seq
MIRT793352	hsa-miR-4690-3p	CLIP-seq
MIRT793358	hsa-miR-4717-5p	CLIP-seq
MIRT2173975	hsa-miR-4740-3p	CLIP-seq
MIRT2173976	hsa-miR-4741	CLIP-seq
MIRT793366	hsa-miR-483-3p	CLIP-seq
MIRT2173977	hsa-miR-485-5p	CLIP-seq
MIRT2384367	hsa-miR-1254	CLIP-seq
MIRT2384368	hsa-miR-3116	CLIP-seq
MIRT793317	hsa-miR-3202	CLIP-seq
MIRT2384369	hsa-miR-4476	CLIP-seq
MIRT2384370	hsa-miR-515-3p	CLIP-seq
MIRT2384371	hsa-miR-519e	CLIP-seq
MIRT2384372	hsa-miR-550a	CLIP-seq
MIRT2384373	hsa-miR-661	CLIP-seq
MIRT2477574	hsa-miR-1285	CLIP-seq
MIRT2477575	hsa-miR-1321	CLIP-seq
MIRT2173967	hsa-miR-188-3p	CLIP-seq
MIRT2477576	hsa-miR-1909	CLIP-seq
MIRT2477577	hsa-miR-1973	CLIP-seq
MIRT2477578	hsa-miR-1976	CLIP-seq
MIRT2477579	hsa-miR-3117-5p	CLIP-seq
MIRT2477580	hsa-miR-3187-5p	CLIP-seq
MIRT2173970	hsa-miR-3909	CLIP-seq
MIRT1934110	hsa-miR-3915	CLIP-seq
MIRT1934111	hsa-miR-3928	CLIP-seq
MIRT2477581	hsa-miR-4270	CLIP-seq
MIRT2477582	hsa-miR-4441	CLIP-seq
MIRT2173971	hsa-miR-4446-3p	CLIP-seq
MIRT1934113	hsa-miR-4494	CLIP-seq
MIRT1934114	hsa-miR-4499	CLIP-seq
MIRT2173974	hsa-miR-4675	CLIP-seq
MIRT2477583	hsa-miR-4722-3p	CLIP-seq
MIRT2477584	hsa-miR-4739	CLIP-seq
MIRT2173975	hsa-miR-4740-3p	CLIP-seq
MIRT2173976	hsa-miR-4741	CLIP-seq
MIRT2477585	hsa-miR-4751	CLIP-seq
MIRT2477586	hsa-miR-4756-5p	CLIP-seq
MIRT2477587	hsa-miR-550b	CLIP-seq
MIRT2477588	hsa-miR-612	CLIP-seq
MIRT2477589	hsa-miR-615-5p	CLIP-seq
MIRT2173967	hsa-miR-188-3p	CLIP-seq
MIRT2477578	hsa-miR-1976	CLIP-seq
MIRT793315	hsa-miR-3194-5p	CLIP-seq
MIRT2173970	hsa-miR-3909	CLIP-seq
MIRT1934110	hsa-miR-3915	CLIP-seq
MIRT1934111	hsa-miR-3928	CLIP-seq
MIRT2173971	hsa-miR-4446-3p	CLIP-seq
MIRT1934113	hsa-miR-4494	CLIP-seq
MIRT1934114	hsa-miR-4499	CLIP-seq
MIRT2173974	hsa-miR-4675	CLIP-seq
MIRT793352	hsa-miR-4690-3p	CLIP-seq
MIRT2477583	hsa-miR-4722-3p	CLIP-seq
MIRT2173975	hsa-miR-4740-3p	CLIP-seq
MIRT2173976	hsa-miR-4741	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	8530503
GO:0005515	Function	Protein binding	IPI
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	19224922
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	16129887
GO:0005829	Component	Cytosol	TAS
GO:0006886	Process	Intracellular protein transport	IBA
GO:0007165	Process	Signal transduction	TAS	8530503
GO:0007369	Process	Gastrulation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8530503
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0034067	Process	Protein localization to Golgi apparatus	IBA
GO:0034067	Process	Protein localization to Golgi apparatus	IMP	19224922
GO:0042147	Process	Retrograde transport, endosome to Golgi	IMP	16129887
GO:0043001	Process	Golgi to plasma membrane protein transport	IBA
GO:0043001	Process	Golgi to plasma membrane protein transport	IMP	16129887, 19224922

MIM	HGNC	e!Ensembl
604699	662	ENSG00000101246

Q13795

Protein name

ADP-ribosylation factor-related protein 1 (ARF-related protein 1) (ARP)

Protein function

Trans-Golgi-associated GTPase that regulates protein sorting. Controls the targeting of ARL1 and its effector to the trans-Golgi. Required for the lipidation of chylomicrons in the intestine and required for VLDL lipidation in the liver. {ECO:00

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00025	Arf	4 → 187	ADP-ribosylation factor family	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in most tissues.

Sequence

MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLN
IGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVT
SEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGI
EWMVKCVVRNVHRPPRQRDIT

Sequence length

201

Interactions

View interactions

	Reactome
			Retrograde transport at the Trans-Golgi-Network

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKERATOSIS CONGENITA, AUTOSOMAL RECESSIVE 5	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	9539779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28440306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36264766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8782080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10767373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10767373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23925294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1321332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	1321332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10767373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17072959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26976208, 30701025, 31213901, 9454907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26881067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17072959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28440306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	25342854	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 5	Spinocerebellar Ataxia	BEFREE	20603325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10767373		★★★★★ ★☆☆☆☆ Found in Text Mining only

ARFRP1 (ARF related protein 1)