Gene Gene information from NCBI Gene database.
Entrez ID 10138
Gene name YY1 associated factor 2
Gene symbol YAF2
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q12
Summary This gene encodes a zinc finger containing protein that functions in the regulation of transcription. This protein was identified as an interacting partner of transcriptional repressor protein Yy1, and also interacts with other transcriptional regulators,
miRNA miRNA information provided by mirtarbase database.
261
miRTarBase ID miRNA Experiments Reference
MIRT027053 hsa-miR-103a-3p Sequencing 20371350
MIRT552804 hsa-miR-107 PAR-CLIP 21572407
MIRT027053 hsa-miR-103a-3p PAR-CLIP 21572407
MIRT552803 hsa-miR-548ac PAR-CLIP 21572407
MIRT552802 hsa-miR-548bb-3p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IBA
GO:0003712 Function Transcription coregulator activity IBA
GO:0003713 Function Transcription coactivator activity IDA 11593398
GO:0003714 Function Transcription corepressor activity IDA 12706874
GO:0003714 Function Transcription corepressor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607534 17363 ENSG00000015153
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IY57
Protein name YY1-associated factor 2
Protein function Binds to MYC and inhibits MYC-mediated transactivation. Also binds to MYCN and enhances MYCN-dependent transcriptional activation. Increases calpain 2-mediated proteolysis of YY1 in vitro. Component of the E2F6.com-1 complex, a repressive comple
PDB 2D9G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00641 zf-RanBP 20 46 Zn-finger in Ran binding protein and others Domain
PF17219 YAF2_RYBP 102 134 Yaf2/RYBP C-terminal binding motif Motif
Sequence
MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLV
AQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTV
GDLTVIITDFKEKT
KSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH
Sequence length 180
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Polycomb repressive complex   RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known
Transcriptional Regulation by E2F6
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
COLOR VISION DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 32950105 Associate
★☆☆☆☆
Found in Text Mining only
Non-Small Cell Lung Carcinoma Lung carcinoma BEFREE 30915747
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease Pubtator 37382256 Associate
★☆☆☆☆
Found in Text Mining only