Gene Gene information from NCBI Gene database.
Entrez ID 10133
Gene name Optineurin
Gene symbol OPTN
Synonyms (NCBI Gene)
ALS12FIP2GLC1EHIP7HYPLNRPTFIIIA-INTP
Chromosome 10
Chromosome location 10p13
Summary This gene encodes the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor
SNPs SNP information provided by dbSNP.
15
SNP ID Visualize variation Clinical significance Consequence
rs11258194 T>A Pathogenic, benign-likely-benign, risk-factor, benign Missense variant, coding sequence variant
rs28939688 G>A Pathogenic Missense variant, coding sequence variant
rs75654767 G>A Pathogenic, benign, likely-benign, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs140599944 G>A,T Uncertain-significance, likely-pathogenic Stop gained, missense variant, coding sequence variant
rs142812715 A>T Pathogenic, uncertain-significance Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
403
miRTarBase ID miRNA Experiments Reference
MIRT019128 hsa-miR-335-5p Microarray 18185580
MIRT021455 hsa-miR-9-5p Microarray 17612493
MIRT050845 hsa-miR-17-5p CLASH 23622248
MIRT050771 hsa-miR-17-3p CLASH 23622248
MIRT049818 hsa-miR-92a-3p CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
NFKB1 Activation 19340308
RELA Activation 19340308
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
47
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0001920 Process Negative regulation of receptor recycling IMP 22854040
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 15837803, 16189514, 17500595, 17646400, 18307994, 19805065, 20174559, 20195357, 20388642, 21516116, 21617041, 21903422, 21988832, 22854040, 23275563, 23414517, 23956131, 24136289, 24705354, 25026213, 25416956, 25803835, 25910212, 26871637, 27086836, 29892012, 30561431, 31515488, 322
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602432 17142 ENSG00000123240
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96CV9
Protein name Optineurin (E3-14.7K-interacting protein) (FIP-2) (Huntingtin yeast partner L) (Huntingtin-interacting protein 7) (HIP-7) (Huntingtin-interacting protein L) (NEMO-related protein) (Optic neuropathy-inducing protein) (Transcription factor IIIA-interacting
Protein function Plays an important role in the maintenance of the Golgi complex, in membrane trafficking, in exocytosis, through its interaction with myosin VI and Rab8 (PubMed:27534431). Links myosin VI to the Golgi complex and plays an important role in Golgi
PDB 2LO4 , 2LUE , 3VTV , 3VTW , 5AAZ , 5B83 , 5EOA , 5EOF , 7CZM , 9B0B , 9B0Z , 9B12 , 9IKQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11577 NEMO 37 104 NF-kappa-B essential modulator NEMO Family
PF16516 CC2-LZ 408 507 Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator Coiled-coil
PF18414 zf_C2H2_10 551 576 Domain
Tissue specificity TISSUE SPECIFICITY: Present in aqueous humor of the eye (at protein level). Expressed in the trabecular meshwork (at protein level) (PubMed:11834836, PubMed:12379221, PubMed:12646749). Expressed in nonpigmented ciliary epithelium (at protein level) (PubMe
Sequence
MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKL
NNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHEN
EKLKEELGKLKGKSER
SSEDPTDDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVE
IRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCL
REGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVE
ALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKK
LELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDR
AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERA
AREKIHEEKEQLALQLAVLLKENDAFE
DGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAE
DRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII
Sequence length 577
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Mitophagy - animal
Autophagy - animal
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
  Regulation of PLK1 Activity at G2/M Transition
TBC/RABGAPs
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
26
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Amyotrophic lateral sclerosis type 10 Likely pathogenic; Pathogenic rs1401721711 RCV002463849
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Amyotrophic lateral sclerosis type 12 Pathogenic; Likely pathogenic rs750571210, rs1370982012, rs2131520977, rs753966040, rs2131488944, rs757559365, rs2131488754, rs778911925, rs759311192, rs774772178, rs768117011, rs1401721711, rs786205611, rs780777015, rs1657737496
View all (26 more)
RCV001958587
RCV001377787
RCV001530974
RCV002541155
RCV005410260
View all (36 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Glaucoma 1, open angle, E Pathogenic; Likely pathogenic rs750571210, rs1370982012, rs753966040, rs757559365, rs2131488754, rs778911925, rs759311192, rs774772178, rs768117011, rs1401721711, rs786205611, rs780777015, rs1657737496, rs1206423781, rs1358641287
View all (21 more)
RCV001958587
RCV001377787
RCV002541155
RCV001902656
RCV001973985
View all (31 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Motor neuron disease Likely pathogenic rs895824243 RCV000492199
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis Uncertain significance ClinVar
CTD, ClinVar, Disgenet, GWAS catalog, Orphanet
CTD, ClinVar, Disgenet, GWAS catalog, Orphanet
CTD, ClinVar, Disgenet, GWAS catalog, Orphanet
CTD, ClinVar, Disgenet, GWAS catalog, Orphanet
CTD, ClinVar, Disgenet, GWAS catalog, Orphanet
CTD, ClinVar, Disgenet, GWAS catalog, Orphanet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
AMYOTROPHIC LATERAL SCLEROSIS 10 Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 21360076, 35666053 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Amyloidosis Amyloidosis BEFREE 29077793
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 20428114, 21074290, 21074902, 21220178, 21550138, 21613650, 21644038, 21802176, 21825243, 21852022, 22015311, 22244934, 22402017, 22762947, 22892313
View all (48 more)
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis CTD_human_DG 21059646, 25096716
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis Amyotrophic lateral sclerosis Pubtator 21408173, 21550138, 23078282, 23100398, 23755159, 23881933, 25294927, 25681989, 25700176, 25801386, 25803835, 25943890, 26303227, 26365381, 26740678
View all (13 more)
Associate
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis ORPHANET_DG 24085347
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis Orphanet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis HPO_DG
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic lateral sclerosis 1 Amyotrophic lateral sclerosis Pubtator 21360076, 31838784 Associate
★☆☆☆☆
Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1 Lateral Sclerosis BEFREE 21613650, 21802176, 22708870
★☆☆☆☆
Found in Text Mining only