TRAP1 (TNF receptor associated protein 1)

Gene

• Entrez ID: 10131
• Gene name: TNF receptor associated protein 1
• Gene symbol: TRAP1
• Synonyms (NCBI Gene): HSP 75, HSP75, HSP90L, TRAP-1
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: This gene encodes a mitochondrial chaperone protein that is member of the heat shock protein 90 (HSP90) family. The encoded protein has ATPase activity and interacts with tumor necrosis factor type I. This protein may function in regulating cellular stres

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs113476582	T>A,C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT031812	hsa-miR-16-5p	Proteomics	18668040
MIRT049372	hsa-miR-92a-3p	qRT-PCR	23622248
MIRT031812	hsa-miR-16-5p	CLASH	23622248
MIRT050940	hsa-miR-17-5p	CLASH	23622248
MIRT050345	hsa-miR-25-3p	CLASH	23622248
MIRT050189	hsa-miR-26a-5p	CLASH	23622248
MIRT049372	hsa-miR-92a-3p	CLASH	23622248
MIRT048268	hsa-miR-196a-5p	CLASH	23622248
MIRT048118	hsa-miR-197-3p	CLASH	23622248
MIRT046825	hsa-miR-222-3p	CLASH	23622248
MIRT045658	hsa-miR-149-5p	CLASH	23622248
MIRT045192	hsa-miR-186-5p	CLASH	23622248
MIRT043734	hsa-miR-342-3p	CLASH	23622248
MIRT043532	hsa-miR-331-3p	CLASH	23622248
MIRT043185	hsa-miR-324-5p	CLASH	23622248
MIRT042452	hsa-miR-424-5p	CLASH	23622248
MIRT041401	hsa-miR-193b-3p	CLASH	23622248
MIRT040106	hsa-miR-615-3p	CLASH	23622248
MIRT039132	hsa-miR-769-3p	CLASH	23622248
MIRT038265	hsa-miR-361-3p	CLASH	23622248
MIRT035913	hsa-miR-1180-3p	CLASH	23622248
MIRT035913	hsa-miR-1180-3p	CLASH	23622248
MIRT1451684	hsa-miR-3151	CLIP-seq
MIRT1451685	hsa-miR-3173-3p	CLIP-seq
MIRT1451686	hsa-miR-3689d	CLIP-seq
MIRT1451687	hsa-miR-4283	CLIP-seq
MIRT1451688	hsa-miR-4489	CLIP-seq
MIRT1451689	hsa-miR-4675	CLIP-seq
MIRT1451690	hsa-miR-4741	CLIP-seq
MIRT1451684	hsa-miR-3151	CLIP-seq
MIRT1451685	hsa-miR-3173-3p	CLIP-seq
MIRT2356356	hsa-miR-320a	CLIP-seq
MIRT2356357	hsa-miR-320b	CLIP-seq
MIRT2356358	hsa-miR-320c	CLIP-seq
MIRT2356359	hsa-miR-320d	CLIP-seq
MIRT2356360	hsa-miR-331-5p	CLIP-seq
MIRT1451686	hsa-miR-3689d	CLIP-seq
MIRT1451687	hsa-miR-4283	CLIP-seq
MIRT2356361	hsa-miR-4429	CLIP-seq
MIRT1451688	hsa-miR-4489	CLIP-seq
MIRT1451689	hsa-miR-4675	CLIP-seq
MIRT1451690	hsa-miR-4741	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005164	Function	Tumor necrosis factor receptor binding	NAS	7876093
GO:0005515	Function	Protein binding	IPI	17579517, 23564345, 23747254, 29128334
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	17579517
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IDA	23564345
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005758	Component	Mitochondrial intermembrane space	ISS	17579517
GO:0005759	Component	Mitochondrial matrix	IDA	23564345
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	TAS	24522549
GO:0009386	Process	Translational attenuation	IMP	24113185
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	17579517
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0070013	Component	Intracellular organelle lumen	IEA
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1901856	Process	Negative regulation of cellular respiration	IMP	23564345
GO:1903427	Process	Negative regulation of reactive oxygen species biosynthetic process	TAS	18221368
GO:1903751	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide	ISS	17579517

Other IDs

• MIM: 606219
• HGNC: 16264
• e!Ensembl: ENSG00000126602

Protein

• UniProt ID: Q12931
• Protein name: Heat shock protein 75 kDa, mitochondrial (HSP 75) (Heat shock protein family C member 5) (TNFR-associated protein 1) (Tumor necrosis factor type 1 receptor-associated protein) (TRAP-1)
• Protein function: Chaperone that expresses an ATPase activity. Involved in maintaining mitochondrial function and polarization, downstream of PINK1 and mitochondrial complex I. Is a negative regulator of mitochondrial respiration able to modulate the balance betw
• PDB: 4Z1F, 4Z1G, 4Z1H, 4Z1I, 5F3K, 5F5R, 5HPH, 5Y3N, 5Y3O, 6XG6, 7C04, 7C05, 7C7B, 7C7C, 7KCK, 7KCL, 7KCM, 7KLU, 7KLV, 7U8U, 7U8V, 7U8W, 7U8X, 7ULK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02518	HATPase_c	108 → 260	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	Domain
  PF00183	HSP90	288 → 704	Hsp90 protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Found in skeletal muscle, liver, heart, brain, kidney, pancreas, lung, placenta and bladder. Expression is highly reduced in bladder cancer and renal cell carcinoma specimens compared to healthy tissues, but it is increased in other ty
• Sequence:

  MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFS
  TQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNA
  SDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGS
  KAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFE
  IAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWM
  MDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELG
  SSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQ
  RLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQL
  TSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLR
  EFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVT
  LRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRAS
  EPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH

• Sequence length: 704

Pathways

KEGG:

Parkinson disease
Pathways of neurodegeneration - multiple diseases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Congenital anomalies of kidney and urinary tract 1	Pathogenic	rs2548299083	RCV003235001	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAKUT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HER2 positive breast carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRAP1-related disorder	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VACTERL/VATER ASSOCIATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VATER association	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	28088229		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23735188, 24297638, 26517089, 28407697		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23735188, 33145341	Associate	★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	GENOMICS_ENGLAND_DG	24152966		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	24875543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	23747254, 26464709, 27662365	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28177905		★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	28177905	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28678347, 29383696		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26408177	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27206315, 27977010		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	26022780	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31039275		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	20828217	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	25493016	Stimulate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	24113185, 36113636, 36273131	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19217207, 21979464, 23139614, 24113185, 25239454, 26084290, 27662365, 28088229, 28177905, 29552185		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21979464, 23139614, 24113185, 24567527, 24962791, 25493016, 26071104, 26084290, 27662365, 28088229, 28177905, 31878280, 33025742, 33065966, 35543151, 36113636, 37796715, 39210159	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	24962791, 25239454, 28177905		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31039275		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	31039275		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24754231		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24754231		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30683653, 31181660		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30683653, 31181660		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25189320, 30683653		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	34338422	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21364753		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31878280	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35543151	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	20393185		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28115289		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	28115289	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	26722505	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29859285, 30758851		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	23273922		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23139614, 26408177	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26722505, 32092740	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	35572591	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	25189320		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26517089, 28407697		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24754231		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	29621137		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29963174		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29383696		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27206315, 27977010		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20499060, 24567527, 27754870		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21364753		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23735188, 24962791, 24990602, 26071104, 27206315, 27422900, 28405578, 28407697, 28664757, 29552185, 29599338, 29621137, 31097545, 31181660, 31669620		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28177905		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26517089		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	25189320		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18570662	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19217207, 23139614, 23376257, 23564345, 23735188, 24754231, 24990602, 25239454, 26071104, 26517089, 27206315, 27977010, 28088229, 28099845, 28177905, 28405578, 28407697, 28678347, 29383696, 29621137, 31181660		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	23273922		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31615807		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24567527, 29383696, 29599338, 30930968		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	18784066	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27206315, 27977010		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22978347, 27206315	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27977010	Inhibit	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	29362886		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17579517, 26631731, 29050400		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	29050400		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20499060, 24567527, 27754870		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	27754870		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31128915		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26464709	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24754231		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34906113	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21364753		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	27422900		★☆☆☆☆ Found in Text Mining only
VACTERL Association	VACTERL Association	BEFREE	24152966, 24875543		★☆☆☆☆ Found in Text Mining only
VACTERL association	Vacterl association	Pubtator	30887706, 34338422	Associate	★☆☆☆☆ Found in Text Mining only
VATER association	Vacterl association	Pubtator	30887706, 34338422	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VATER/VACTERL ASSOCIATION	VACTERL ASSOCIATION	GENOMICS_ENGLAND_DG	24152966		★☆☆☆☆ Found in Text Mining only
VATER/VACTERL ASSOCIATION	VACTERL ASSOCIATION	BEFREE	30887706		★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	23525905		★☆☆☆☆ Found in Text Mining only