Gene Gene information from NCBI Gene database.
Entrez ID 10127
Gene name Zinc finger protein 263
Gene symbol ZNF263
Synonyms (NCBI Gene)
FPM315ZKSCAN12ZSCAN44
Chromosome 16
Chromosome location 16p13.3
miRNA miRNA information provided by mirtarbase database.
99
miRTarBase ID miRNA Experiments Reference
MIRT026455 hsa-miR-192-5p Sequencing 20371350
MIRT040352 hsa-miR-615-3p CLASH 23622248
MIRT1519786 hsa-miR-1 CLIP-seq
MIRT1519787 hsa-miR-1258 CLIP-seq
MIRT1519788 hsa-miR-1295 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 19887448, 32051553
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 32277030
GO:0000976 Function Transcription cis-regulatory region binding IDA 32051553, 32277030
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604191 13056 ENSG00000006194
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14978
Protein name Zinc finger protein 263 (Zinc finger protein FPM315) (Zinc finger protein with KRAB and SCAN domains 12)
Protein function Transcription factor that binds to the consensus sequence 5'-TCCTCCC-3' and acts as a transcriptional repressor (PubMed:32051553). Binds to the promoter region of SIX3 and recruits other proteins involved in chromatin modification and transcript
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 37 125 SCAN domain Domain
PF01352 KRAB 218 257 KRAB box Family
PF00096 zf-C2H2 378 400 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 434 456 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 462 484 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 490 512 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 518 540 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 575 597 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 603 625 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 631 653 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 659 681 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocyte. {ECO:0000269|PubMed:9256059}.
Sequence
MASGPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGR
LRQQVTNHGRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKERALSAPWLSLFPPEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA
LSRDTVQESYENVDSLE
SHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEEKF
ENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPHDRSQGDWAPPPEGGMEQALAGA
SSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCTEIFGGNPR
FLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRH
QRTH
TGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTH
ERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGE
KPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYK
CSECGESFSRSSRLMSHQRTH
TG
Sequence length 683
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
TYPE 2 DIABETES MELLITUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arteriosclerosis Arteriosclerosis BEFREE 24819318
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 24819318
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis Pubtator 24819318 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 27458175 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 34514002, 36035369 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 39294234 Associate
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma Pubtator 32051553 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Myeloid leukemia Pubtator 31537905 Associate
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Lymphatic metastasis Pubtator 39294234 Stimulate
★☆☆☆☆
Found in Text Mining only
Pulmonary Disease Chronic Obstructive Chronic obstructive pulmonary disease Pubtator 37065635 Associate
★☆☆☆☆
Found in Text Mining only