SGK2 (serum/glucocorticoid regulated kinase 2)

Gene

• Entrez ID: 10110
• Gene name: Serum/glucocorticoid regulated kinase 2
• Gene symbol: SGK2
• Synonyms (NCBI Gene): H-SGK2, dJ138B7.2
• Chromosome: 20
• Chromosome location: 20q13.12
• Summary: This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that ac

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2101414	hsa-miR-3124-3p	CLIP-seq
MIRT2101415	hsa-miR-3127-3p	CLIP-seq
MIRT2325779	hsa-miR-1207-5p	CLIP-seq
MIRT2325780	hsa-miR-1273f	CLIP-seq
MIRT2325781	hsa-miR-143	CLIP-seq
MIRT2325782	hsa-miR-298	CLIP-seq
MIRT2325783	hsa-miR-3174	CLIP-seq
MIRT2325784	hsa-miR-3606	CLIP-seq
MIRT2325785	hsa-miR-4436b-3p	CLIP-seq
MIRT2325786	hsa-miR-4708-5p	CLIP-seq
MIRT2325787	hsa-miR-4736	CLIP-seq
MIRT2325788	hsa-miR-4761-5p	CLIP-seq
MIRT2325789	hsa-miR-4763-3p	CLIP-seq
MIRT2325790	hsa-miR-4770	CLIP-seq
MIRT2325791	hsa-miR-671-5p	CLIP-seq
MIRT2325792	hsa-miR-921	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001558	Process	Regulation of cell growth	TAS	20919962
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	10548550
GO:0005515	Function	Protein binding	IPI	22939624, 32296183, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	NAS	12397388
GO:0006468	Process	Protein phosphorylation	TAS	10548550
GO:0006979	Process	Response to oxidative stress	TAS	10548550
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IDA	12397388
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017080	Function	Sodium channel regulator activity	IEA
GO:0017080	Function	Sodium channel regulator activity	NAS	12632189
GO:0017080	Function	Sodium channel regulator activity	TAS	16460280
GO:0032411	Process	Positive regulation of transporter activity	TAS	16460280
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	TAS	10548550
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	TAS	20919962
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 607589
• HGNC: 13900
• e!Ensembl: ENSG00000101049

Protein

• UniProt ID: Q9HBY8
• Protein name: Serine/threonine-protein kinase Sgk2 (EC 2.7.11.1) (Serum/glucocorticoid-regulated kinase 2)
• Protein function: Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, survival and proliferation. Up-regulates Na(+) channels: SCNN1A/ENAC, K(+) channels: KCNA3/Kv1.3, KCNE1 an
• Family and domains:

  Pfam

  
  Warning: Undefined array key 372 in /var/www/html/gene_detail.php on line 1100
  
  Warning: Undefined array key 416 in /var/www/html/gene_detail.php on line 1100
  

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	95 → 352	Protein kinase domain	Domain
  PF00433	Pkinase_C	373 → 417	Protein kinase C terminal domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in liver, kidney and pancreas, and at lower levels in brain. {ECO:0000269|PubMed:10548550}.
• Sequence:

  MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAF
  YAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGE
  LFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGL
  CKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVS
  QMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDL
  YHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPE
  DDDILDC

• Sequence length: 367

Pathways

KEGG:

FoxO signaling pathway
PI3K-Akt signaling pathway

Reactome:

Stimuli-sensing channels

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Colorectal cancer	Likely pathogenic	rs35187177	RCV001543614	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations