KCNK7 (potassium two pore domain channel subfamily K member 7)

Gene

• Entrez ID: 10089
• Gene name: Potassium two pore domain channel subfamily K member 7
• Gene symbol: KCNK7
• Synonyms (NCBI Gene): K2p7.1, TWIK3
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: This gene encodes a member of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel; however, it may require other non-pore-forming proteins for activity

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017736	hsa-miR-335-5p	Microarray	18185580
MIRT2555496	hsa-miR-18a	CLIP-seq
MIRT2555497	hsa-miR-18b	CLIP-seq
MIRT2555498	hsa-miR-3150a-3p	CLIP-seq
MIRT2555499	hsa-miR-3150b-3p	CLIP-seq
MIRT2555500	hsa-miR-3175	CLIP-seq
MIRT2555501	hsa-miR-4434	CLIP-seq
MIRT2555502	hsa-miR-4516	CLIP-seq
MIRT2555503	hsa-miR-4667-5p	CLIP-seq
MIRT2555504	hsa-miR-4700-5p	CLIP-seq
MIRT2555505	hsa-miR-4735-3p	CLIP-seq
MIRT2555506	hsa-miR-4784	CLIP-seq
MIRT2555507	hsa-miR-765	CLIP-seq
MIRT2555508	hsa-miR-939	CLIP-seq
MIRT2555496	hsa-miR-18a	CLIP-seq
MIRT2555497	hsa-miR-18b	CLIP-seq
MIRT2555498	hsa-miR-3150a-3p	CLIP-seq
MIRT2555499	hsa-miR-3150b-3p	CLIP-seq
MIRT2555500	hsa-miR-3175	CLIP-seq
MIRT2555501	hsa-miR-4434	CLIP-seq
MIRT2555502	hsa-miR-4516	CLIP-seq
MIRT2555503	hsa-miR-4667-5p	CLIP-seq
MIRT2555504	hsa-miR-4700-5p	CLIP-seq
MIRT2555505	hsa-miR-4735-3p	CLIP-seq
MIRT2555506	hsa-miR-4784	CLIP-seq
MIRT2555507	hsa-miR-765	CLIP-seq
MIRT2555508	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005267	Function	Potassium channel activity	IEA
GO:0005267	Function	Potassium channel activity	TAS	10206991
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	TAS	10206991
GO:0015271	Function	Outward rectifier potassium channel activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0022841	Function	Potassium ion leak channel activity	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA

Other IDs

• MIM: 603940
• HGNC: 6282
• e!Ensembl: ENSG00000173338

Protein

• UniProt ID: Q9Y2U2
• Protein name: Potassium channel subfamily K member 7
• Protein function: Probable potassium channel subunit. No channel activity observed in vitro as protein remains in the endoplasmic reticulum. May need to associate with an as yet unknown partner in order to reach the plasma membrane.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07885	Ion_trans_2	66 → 145	Ion channel	Family
  PF07885	Ion_trans_2	172 → 261	Ion channel	Family

• Sequence:

  MGGLRPWSRYGLLVVAHLLALGLGAVVFQALEGPPACRLQAELRAELAAFQAEHRACLPP
  GALEELLGTALATQAHGVSTLGNSSEGRTWDLPSALLFAASILTTTGYGHMAPLSPGGKA
  FCMVYAALGLPASLALVATLRHCLLPVLSRPRAWVAVHWQLSPARAALLQAVALGLLVAS
  SFVLLPALVLWGLQGDCSLLGAVYFCFSSLSTIGLEDLLPGRGRSLHPVIYHLGQLALLG
  YLLLGLLAMLLAVETFSELPQVRAMGKFFRPSGPVTAEDQGGILGQDELALSTLPPAAPA
  SGQAPAC

• Sequence length: 307

Pathways

Reactome:

Tandem of pore domain in a weak inwardly rectifying K+ channels (TWIK)
Phase 4 - resting membrane potential

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	32512817	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	25437921		★☆☆☆☆ Found in Text Mining only