Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10085
Gene name	EGF like repeats and discoidin domains 3
Gene symbol	EDIL3
Synonyms (NCBI Gene)	DEL1
Chromosome	5
Chromosome location	5q14.3
Summary	The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq, Jul 2008]

179

Show/Hide all (179)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030686	hsa-miR-21-5p	Microarray	18591254
MIRT611638	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611637	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611636	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611635	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611634	hsa-miR-548z	HITS-CLIP	23824327
MIRT611633	hsa-miR-548aa	HITS-CLIP	23824327
MIRT611632	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT611631	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT648501	hsa-miR-8060	HITS-CLIP	23824327
MIRT648500	hsa-miR-7154-5p	HITS-CLIP	23824327
MIRT611629	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT611638	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611637	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611636	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611635	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611634	hsa-miR-548z	HITS-CLIP	23824327
MIRT611633	hsa-miR-548aa	HITS-CLIP	23824327
MIRT611632	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT611631	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT611630	hsa-miR-4328	HITS-CLIP	23824327
MIRT648501	hsa-miR-8060	HITS-CLIP	23824327
MIRT648500	hsa-miR-7154-5p	HITS-CLIP	23824327
MIRT611629	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT611638	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611637	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611636	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611635	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611634	hsa-miR-548z	HITS-CLIP	23824327
MIRT611633	hsa-miR-548aa	HITS-CLIP	23824327
MIRT611632	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT611631	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT611630	hsa-miR-4328	HITS-CLIP	23824327
MIRT611629	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT611638	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611637	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611636	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611635	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611634	hsa-miR-548z	HITS-CLIP	23824327
MIRT611633	hsa-miR-548aa	HITS-CLIP	23824327
MIRT611632	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT611631	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT611630	hsa-miR-4328	HITS-CLIP	23824327
MIRT611629	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT530958	hsa-miR-1264	PAR-CLIP	22012620
MIRT530957	hsa-miR-8063	PAR-CLIP	22012620
MIRT530956	hsa-miR-4698	PAR-CLIP	22012620
MIRT530955	hsa-miR-1228-3p	PAR-CLIP	22012620
MIRT530954	hsa-miR-3691-3p	PAR-CLIP	22012620
MIRT530953	hsa-miR-676-5p	PAR-CLIP	22012620
MIRT530952	hsa-miR-377-3p	PAR-CLIP	22012620
MIRT611638	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611637	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611636	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611635	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611634	hsa-miR-548z	HITS-CLIP	23824327
MIRT611633	hsa-miR-548aa	HITS-CLIP	23824327
MIRT611632	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT611631	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT648501	hsa-miR-8060	HITS-CLIP	23824327
MIRT648500	hsa-miR-7154-5p	HITS-CLIP	23824327
MIRT611629	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT611638	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611637	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611636	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611635	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611634	hsa-miR-548z	HITS-CLIP	23824327
MIRT611633	hsa-miR-548aa	HITS-CLIP	23824327
MIRT611632	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT611631	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT611630	hsa-miR-4328	HITS-CLIP	23824327
MIRT648501	hsa-miR-8060	HITS-CLIP	23824327
MIRT648500	hsa-miR-7154-5p	HITS-CLIP	23824327
MIRT611629	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT611638	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611637	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611636	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611635	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611634	hsa-miR-548z	HITS-CLIP	23824327
MIRT611633	hsa-miR-548aa	HITS-CLIP	23824327
MIRT611632	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT611631	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT611630	hsa-miR-4328	HITS-CLIP	23824327
MIRT611629	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT611638	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611637	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611636	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611635	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611634	hsa-miR-548z	HITS-CLIP	23824327
MIRT611633	hsa-miR-548aa	HITS-CLIP	23824327
MIRT611632	hsa-miR-548ap-3p	HITS-CLIP	23824327
MIRT611631	hsa-miR-548t-3p	HITS-CLIP	23824327
MIRT611630	hsa-miR-4328	HITS-CLIP	23824327
MIRT611629	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT530958	hsa-miR-1264	PAR-CLIP	22012620
MIRT530957	hsa-miR-8063	PAR-CLIP	22012620
MIRT530956	hsa-miR-4698	PAR-CLIP	22012620
MIRT530955	hsa-miR-1228-3p	PAR-CLIP	22012620
MIRT530954	hsa-miR-3691-3p	PAR-CLIP	22012620
MIRT530953	hsa-miR-676-5p	PAR-CLIP	22012620
MIRT530952	hsa-miR-377-3p	PAR-CLIP	22012620
MIRT952652	hsa-miR-3672	CLIP-seq
MIRT1548157	hsa-miR-103a	CLIP-seq
MIRT1548158	hsa-miR-107	CLIP-seq
MIRT1548159	hsa-miR-3117-5p	CLIP-seq
MIRT1548160	hsa-miR-3129-3p	CLIP-seq
MIRT1548161	hsa-miR-361-5p	CLIP-seq
MIRT1548162	hsa-miR-425	CLIP-seq
MIRT1548163	hsa-miR-4496	CLIP-seq
MIRT1548164	hsa-miR-4639-5p	CLIP-seq
MIRT1548165	hsa-miR-496	CLIP-seq
MIRT1548166	hsa-miR-656	CLIP-seq
MIRT1548167	hsa-miR-889	CLIP-seq
MIRT1548157	hsa-miR-103a	CLIP-seq
MIRT1548158	hsa-miR-107	CLIP-seq
MIRT2216946	hsa-miR-19a	CLIP-seq
MIRT2216947	hsa-miR-19b	CLIP-seq
MIRT2216948	hsa-miR-2113	CLIP-seq
MIRT2216949	hsa-miR-2116	CLIP-seq
MIRT2216950	hsa-miR-375	CLIP-seq
MIRT2216951	hsa-miR-4273	CLIP-seq
MIRT2216952	hsa-miR-4677-5p	CLIP-seq
MIRT2216953	hsa-miR-4693-3p	CLIP-seq
MIRT1548166	hsa-miR-656	CLIP-seq
MIRT2448668	hsa-miR-3163	CLIP-seq
MIRT2448668	hsa-miR-3163	CLIP-seq
MIRT2465198	hsa-miR-3685	CLIP-seq
MIRT2465199	hsa-miR-384	CLIP-seq
MIRT2521071	hsa-miR-1277	CLIP-seq
MIRT2521072	hsa-miR-137	CLIP-seq
MIRT1548159	hsa-miR-3117-5p	CLIP-seq
MIRT2521073	hsa-miR-3121-3p	CLIP-seq
MIRT1548160	hsa-miR-3129-3p	CLIP-seq
MIRT2521074	hsa-miR-3143	CLIP-seq
MIRT2448668	hsa-miR-3163	CLIP-seq
MIRT1548161	hsa-miR-361-5p	CLIP-seq
MIRT2521075	hsa-miR-3622a-5p	CLIP-seq
MIRT952652	hsa-miR-3672	CLIP-seq
MIRT2521076	hsa-miR-3684	CLIP-seq
MIRT2521077	hsa-miR-3714	CLIP-seq
MIRT2521078	hsa-miR-3978	CLIP-seq
MIRT2521079	hsa-miR-4261	CLIP-seq
MIRT2521080	hsa-miR-4275	CLIP-seq
MIRT2521081	hsa-miR-4423-3p	CLIP-seq
MIRT1548163	hsa-miR-4496	CLIP-seq
MIRT1548164	hsa-miR-4639-5p	CLIP-seq
MIRT2521082	hsa-miR-4645-3p	CLIP-seq
MIRT2521083	hsa-miR-4668-3p	CLIP-seq
MIRT1548165	hsa-miR-496	CLIP-seq
MIRT2521084	hsa-miR-543	CLIP-seq
MIRT2521085	hsa-miR-548ae	CLIP-seq
MIRT2521086	hsa-miR-548aj	CLIP-seq
MIRT2521087	hsa-miR-548am	CLIP-seq
MIRT2521088	hsa-miR-548an	CLIP-seq
MIRT2521089	hsa-miR-548x	CLIP-seq
MIRT2521090	hsa-miR-940	CLIP-seq
MIRT2521091	hsa-miR-944	CLIP-seq
MIRT2521071	hsa-miR-1277	CLIP-seq
MIRT2521072	hsa-miR-137	CLIP-seq
MIRT2521074	hsa-miR-3143	CLIP-seq
MIRT2448668	hsa-miR-3163	CLIP-seq
MIRT1548161	hsa-miR-361-5p	CLIP-seq
MIRT2521075	hsa-miR-3622a-5p	CLIP-seq
MIRT952652	hsa-miR-3672	CLIP-seq
MIRT2521076	hsa-miR-3684	CLIP-seq
MIRT2521077	hsa-miR-3714	CLIP-seq
MIRT2521079	hsa-miR-4261	CLIP-seq
MIRT2521081	hsa-miR-4423-3p	CLIP-seq
MIRT1548164	hsa-miR-4639-5p	CLIP-seq
MIRT2679768	hsa-miR-4640-3p	CLIP-seq
MIRT2521082	hsa-miR-4645-3p	CLIP-seq
MIRT2521083	hsa-miR-4668-3p	CLIP-seq
MIRT2521084	hsa-miR-543	CLIP-seq
MIRT2521085	hsa-miR-548ae	CLIP-seq
MIRT2521086	hsa-miR-548aj	CLIP-seq
MIRT2521087	hsa-miR-548am	CLIP-seq
MIRT2521088	hsa-miR-548an	CLIP-seq
MIRT2521089	hsa-miR-548x	CLIP-seq
MIRT2521090	hsa-miR-940	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005178	Function	Integrin binding	TAS	9420328
GO:0005201	Function	Extracellular matrix structural constituent	RCA	23979707, 27068509, 28327460
GO:0005509	Function	Calcium ion binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IBA
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0031012	Component	Extracellular matrix	HDA	23979707, 27068509, 28327460
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	21362503
GO:1903561	Component	Extracellular vesicle	HDA	24769233

MIM	HGNC	e!Ensembl
606018	3173	ENSG00000164176

O43854

Protein name

EGF-like repeat and discoidin I-like domain-containing protein 3 (Developmentally-regulated endothelial cell locus 1 protein) (Integrin-binding protein DEL1)

Protein function

Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development.

PDB

4D90

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00008	EGF	26 → 58	EGF-like domain	Domain
PF00008	EGF	78 → 115	EGF-like domain	Domain
PF12661	hEGF	128 → 146	Human growth factor-like EGF	Domain
PF00754	F5_F8_type_C	173 → 311	F5/8 type C domain	Domain
PF00754	F5_F8_type_C	334 → 473	F5/8 type C domain	Domain

Sequence

MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCS
SVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI
NECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTH
RALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSP
EYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQV
CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDK
QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

Sequence length

480

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (94)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	8646748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26545781, 28819306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37657448	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	23308121		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26735172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	GWASCAT_DG	31116379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24530986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29393238, 31110935, 31330520, 7814151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33832090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17006932, 20857535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24530986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26545781, 29076184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	18534562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	9723029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	28643381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19292890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19292890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	19380029, 2479409, 9723029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	3162227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital malformation syndrome	Congenital Malformation Syndrome	BEFREE	1633642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18534562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27505251, 30278915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	33862081	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17495183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dihydropyrimidine Dehydrogenase Deficiency	Dihydropyrimidine Dehydrogenase Deficiency	BEFREE	19296131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	19763616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	3965122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enchondromatosis	Enchondromatosis	BEFREE	9723029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30961491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30961491	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	12363475		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	12363475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	7814151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	12655498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	33936064	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	BEFREE	12034524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	669715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	17937435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intermittent Claudication	Claudication	Pubtator	15212720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	32367296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	18534562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isodicentric Chromosome 15 Syndrome	Isodicentric Chromosome 15 Syndrome	BEFREE	11746042		★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	2702621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12547161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25273699, 25980764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30885428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	10233841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	8180392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	38195611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19292890, 29393238, 31110935, 31330520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30961491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26545781, 29076184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26735172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24530986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19292890, 22782704, 23136083, 26545781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19292890		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19292890, 31622599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	17937435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	23518061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15736465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26374165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	18534562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14610084, 19292890, 22782704, 25273699, 26735172, 30961491, 31110935, 31330520, 8631024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1933825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28819306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20950786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	22710961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21279997	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31110935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32912111	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26735172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	33862081	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	7814151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	669715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28643381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	26374165, 28643381, 30885428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	15212720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peroxisome biogenesis disorders	Zellweger Syndrome	BEFREE	7814151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10233841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	12439901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33901217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	3375199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26644074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28447099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	28447099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31506547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	26644074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37576496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29393238, 31817673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31817673, 33832090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	16320247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	22710961		★★★★★ ★☆☆☆☆ Found in Text Mining only

EDIL3 (EGF like repeats and discoidin domains 3)