TSPAN32 (tetraspanin 32)

Gene

• Entrez ID: 10077
• Gene name: Tetraspanin 32
• Gene symbol: TSPAN32
• Synonyms (NCBI Gene): ART1, PHEMX, PHMX, TSSC6
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: This gene, which is a member of the tetraspanin superfamily, is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region ha

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1459780	hsa-miR-1178	CLIP-seq
MIRT1459781	hsa-miR-138	CLIP-seq
MIRT1459782	hsa-miR-140-3p	CLIP-seq
MIRT1459783	hsa-miR-3126-5p	CLIP-seq
MIRT1459784	hsa-miR-4700-3p	CLIP-seq
MIRT1459785	hsa-miR-493	CLIP-seq
MIRT1459786	hsa-miR-501-3p	CLIP-seq
MIRT1459787	hsa-miR-502-3p	CLIP-seq
MIRT1459788	hsa-miR-767-5p	CLIP-seq
MIRT1459781	hsa-miR-138	CLIP-seq
MIRT1459785	hsa-miR-493	CLIP-seq
MIRT1459786	hsa-miR-501-3p	CLIP-seq
MIRT1459787	hsa-miR-502-3p	CLIP-seq
MIRT1459788	hsa-miR-767-5p	CLIP-seq
MIRT1459784	hsa-miR-4700-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IBA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	10950922
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0023052	Process	Signaling	IEA
GO:0030886	Process	Negative regulation of myeloid dendritic cell activation	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0042832	Process	Defense response to protozoan	IEA
GO:0050688	Process	Regulation of defense response to virus	IEA
GO:0070442	Component	Integrin alphaIIb-beta3 complex	IEA
GO:0070527	Process	Platelet aggregation	IEA
GO:1900746	Process	Regulation of vascular endothelial growth factor signaling pathway	IBA

Other IDs

• MIM: 603853
• HGNC: 13410
• e!Ensembl: ENSG00000064201

Protein

• UniProt ID: Q96QS1
• Protein name: Tetraspanin-32 (Tspan-32) (Protein Phemx)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00335	Tetraspanin	10 → 222	Tetraspanin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed ubiquitously at low levels. High levels of expression are confined to hematopoietic tissues including peripheral blood leukocytes, thymus and spleen. {ECO:0000269|PubMed:10072438}.
• Sequence:

  MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQW
  AFSAGLSLVGLLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVE
  DAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR
  EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLDRKGKYTLTPR
  ACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHR
  ALQGRSRGGLSGCPERGLSD

• Sequence length: 320

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis	Arthritis	BEFREE	30938236		★☆☆☆☆ Found in Text Mining only
Astigmatism	Astigmatism	BEFREE	30918811		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	25180572	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25180572		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	25180572	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31487788		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34207245	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	40572059	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23652727, 26847718, 27277835, 28138708		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26847718		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29703930	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20353610	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27466078		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27466078		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27466078		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27466078	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	29463868		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29507275		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29037295		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24970008		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34207245	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	8993978		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30066849		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33751038	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31487788		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28420597		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26847718, 28138708, 30066849		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	8993978		★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	29703930	Associate	★☆☆☆☆ Found in Text Mining only
Regular astigmatism - corneal	Corneal astigmatism	BEFREE	30918811		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17614107		★☆☆☆☆ Found in Text Mining only