IL18BP (interleukin 18 binding protein)

Gene

• Entrez ID: 10068
• Gene name: Interleukin 18 binding protein
• Gene symbol: IL18BP
• Synonyms (NCBI Gene): FVH, IL18BPa
• Chromosome: 11
• Chromosome location: 11q13.4
• Summary: The protein encoded by this gene functions as an inhibitor of the proinflammatory cytokine, IL18. It binds IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1590835834	TCTGCCTTCACTTCCCTAGGCTGGGCTGAGGGCAACCTTG>-	Risk-factor	3 prime UTR variant, coding sequence variant, splice acceptor variant, intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018976	hsa-miR-335-5p	Microarray	18185580
MIRT1064137	hsa-miR-122	CLIP-seq
MIRT1064138	hsa-miR-1291	CLIP-seq
MIRT1064139	hsa-miR-1296	CLIP-seq
MIRT1064140	hsa-miR-2115	CLIP-seq
MIRT1064141	hsa-miR-299-3p	CLIP-seq
MIRT1064142	hsa-miR-3074-5p	CLIP-seq
MIRT1064143	hsa-miR-3153	CLIP-seq
MIRT1064144	hsa-miR-3180-5p	CLIP-seq
MIRT1064145	hsa-miR-3188	CLIP-seq
MIRT1064146	hsa-miR-3607-5p	CLIP-seq
MIRT1064147	hsa-miR-3665	CLIP-seq
MIRT1064148	hsa-miR-3689a-3p	CLIP-seq
MIRT1064149	hsa-miR-3689c	CLIP-seq
MIRT1064150	hsa-miR-370	CLIP-seq
MIRT1064151	hsa-miR-4254	CLIP-seq
MIRT1064152	hsa-miR-4259	CLIP-seq
MIRT1064153	hsa-miR-4308	CLIP-seq
MIRT1064154	hsa-miR-4326	CLIP-seq
MIRT1064155	hsa-miR-4425	CLIP-seq
MIRT1064156	hsa-miR-4512	CLIP-seq
MIRT1064157	hsa-miR-4648	CLIP-seq
MIRT1064158	hsa-miR-4654	CLIP-seq
MIRT1064159	hsa-miR-4663	CLIP-seq
MIRT1064160	hsa-miR-4668-5p	CLIP-seq
MIRT1064161	hsa-miR-4728-5p	CLIP-seq
MIRT1064162	hsa-miR-4769-5p	CLIP-seq
MIRT1064163	hsa-miR-520a-5p	CLIP-seq
MIRT1064164	hsa-miR-525-5p	CLIP-seq
MIRT1064165	hsa-miR-587	CLIP-seq
MIRT1064166	hsa-miR-627	CLIP-seq
MIRT1064167	hsa-miR-657	CLIP-seq
MIRT1064168	hsa-miR-924	CLIP-seq
MIRT1064159	hsa-miR-4663	CLIP-seq
MIRT1064160	hsa-miR-4668-5p	CLIP-seq
MIRT1064165	hsa-miR-587	CLIP-seq
MIRT1064166	hsa-miR-627	CLIP-seq
MIRT1064168	hsa-miR-924	CLIP-seq
MIRT1064142	hsa-miR-3074-5p	CLIP-seq
MIRT1064150	hsa-miR-370	CLIP-seq
MIRT1064154	hsa-miR-4326	CLIP-seq
MIRT1064159	hsa-miR-4663	CLIP-seq
MIRT1064165	hsa-miR-587	CLIP-seq
MIRT1064166	hsa-miR-627	CLIP-seq
MIRT1064168	hsa-miR-924	CLIP-seq
MIRT1064137	hsa-miR-122	CLIP-seq
MIRT1064138	hsa-miR-1291	CLIP-seq
MIRT1064139	hsa-miR-1296	CLIP-seq
MIRT2451712	hsa-miR-130a	CLIP-seq
MIRT2451713	hsa-miR-130b	CLIP-seq
MIRT2451714	hsa-miR-301a	CLIP-seq
MIRT2451715	hsa-miR-301b	CLIP-seq
MIRT2451716	hsa-miR-3666	CLIP-seq
MIRT1064151	hsa-miR-4254	CLIP-seq
MIRT2451717	hsa-miR-4295	CLIP-seq
MIRT1064153	hsa-miR-4308	CLIP-seq
MIRT1064156	hsa-miR-4512	CLIP-seq
MIRT2451718	hsa-miR-454	CLIP-seq
MIRT2451719	hsa-miR-4708-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	10023777
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0042007	Function	Interleukin-18 binding	IBA
GO:0042007	Function	Interleukin-18 binding	IDA	10023777
GO:0042007	Function	Interleukin-18 binding	IEA
GO:0042088	Process	T-helper 1 type immune response	IBA
GO:0042088	Process	T-helper 1 type immune response	IDA	10023777
GO:0048019	Function	Receptor antagonist activity	TAS	11890646
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA

Other IDs

• MIM: 604113
• HGNC: 5987
• e!Ensembl: ENSG00000137496

Protein

• UniProt ID: O95998
• Protein name: Interleukin-18-binding protein (IL-18BP) (Tadekinig-alfa)
• Protein function: Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.
• PDB: 7AL7
• Tissue specificity: TISSUE SPECIFICITY: Strongly expressed in heart, lung, placenta and spleen. {ECO:0000269|PubMed:10023777, ECO:0000269|PubMed:10094485}.
• Sequence:

  MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPA
  AKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTS
  RERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQ
  EALPSSHSSPQQQG

• Sequence length: 194

Pathways

Reactome:

Interleukin-37 signaling
Interleukin-18 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis, fulminant viral, susceptibility to	risk factor; Likely benign	ClinVar ClinVar, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	11698468		★☆☆☆☆ Found in Text Mining only
Acute Kidney Tubular Necrosis	Renal tubular necrosis	BEFREE	18753296		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22272623	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	31427887	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20663688		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15188356, 21834067	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34530864	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28922563		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20663688		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27649785		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	27821270		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29387062		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36443508	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	27821270		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24963217, 26657115	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23873689		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	15371332		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	29485097		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10673399		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11739524	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24531812		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19805173		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	17951325		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	11907126		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17318554		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31032897		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	25576800	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39434299	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	14679086, 25576800		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	31427887		★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	17318554		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28839348		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23873689		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24531812		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	22289535		★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	12165091	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	20072626		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	19077159, 19797730, 23556537		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30541566		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17318554		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	18753296		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36308662	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	31213488	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	16978540, 20140691		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	16978540	Stimulate	★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	29295842, 31192813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29387062		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29599908		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10673399, 25548255, 28352119		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30541566		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20644165		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	19805173		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23873689, 29599908		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	29422069		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	16978540	Stimulate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29656686		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	27649785		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	24963217	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24963217, 31257224	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29599908		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	26438531		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25351720	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21883889, 34348529	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30527805, 30870716		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30301527, 30527805		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12632414, 15188356, 17367819, 27649785		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17318554		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	31837215		★☆☆☆☆ Found in Text Mining only