SCAMP2 (secretory carrier membrane protein 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 10066
Gene name Secretory carrier membrane protein 2
Gene symbol SCAMP2
Synonyms (NCBI Gene)
-
Chromosome 15
Chromosome location 15q24.1
Summary This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes
miRNA miRNA information provided by mirtarbase database.
187
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (187)
miRTarBase ID miRNA Experiments Reference
MIRT020269 hsa-miR-130b-3p Sequencing 20371350
MIRT023203 hsa-miR-124-3p Microarray 18668037
MIRT025921 hsa-miR-7-5p Microarray 19073608
MIRT050416 hsa-miR-23a-3p CLASH 23622248
MIRT037485 hsa-miR-744-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (16)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15840657, 16870614, 19276089, 32296183, 32814053
GO:0005768 Component Endosome IEA
GO:0005794 Component Golgi apparatus IDA
GO:0005794 Component Golgi apparatus IEA
GO:0006887 Process Exocytosis IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
606912 10564 ENSG00000140497
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15127
Protein name Secretory carrier-associated membrane protein 2 (Secretory carrier membrane protein 2)
Protein function Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04144 SCAMP 117 → 293 SCAMP family Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed.
Sequence 
MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQP
AVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNW
PPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSK
GVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIP
GLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQA
QEEFSQGIFSSRTFHRAASSAAQGAFQGN
Sequence length 329
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (5)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST CANCER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer Uncertain significance ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (5)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma GWASCAT_DG 29059683
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Carcinogenesis Carcinogenesis Pubtator 34426610 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Immune thrombocytopenic purpura Immune Thrombocytopenic Purpura BEFREE 27781392
★★★★★
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Myeloid leukemia Pubtator 34426610 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Pancreatic Neoplasms Pancreatic neoplasm Pubtator 33493138 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only