Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10059
Gene name	Dynamin 1 like
Gene symbol	DNM1L
Synonyms (NCBI Gene)	DLP1DRP1DVLPDYMPLEEMPFEMPF1HDYNIVOPA5
Chromosome	12
Chromosome location	12p11.21
Summary	This gene encodes a member of the dynamin superfamily of GTPases. The encoded protein mediates mitochondrial and peroxisomal division, and is involved in developmentally regulated apoptosis and programmed necrosis. Dysfunction of this gene is implicated i

Show/Hide all (10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs745921568	A>T	Likely-pathogenic	Coding sequence variant, stop gained, 5 prime UTR variant
rs879255686	->A	Pathogenic	Coding sequence variant, intron variant, frameshift variant
rs879255687	GA>-	Pathogenic	5 prime UTR variant, coding sequence variant, intron variant, frameshift variant
rs879255688	A>G	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs1057523007	G>C	Likely-pathogenic	5 prime UTR variant, missense variant, coding sequence variant
rs1057523861	G>A	Likely-pathogenic	Intron variant, 5 prime UTR variant, missense variant, coding sequence variant
rs1555119216	C>A	Pathogenic	Missense variant, coding sequence variant, intron variant
rs1555229948	A>C	Pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant
rs1555229978	AACA>CACT	Likely-pathogenic	Stop gained, 5 prime UTR variant, coding sequence variant
rs1592631789	->AA	Pathogenic	Coding sequence variant, frameshift variant

379

Show/Hide all (379)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050255	hsa-miR-25-3p	CLASH	23622248
MIRT039911	hsa-miR-615-3p	CLASH	23622248
MIRT134280	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT134275	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT134280	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT134274	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT134283	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT134276	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT134288	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT134275	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT731893	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	28347692
MIRT731893	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	28347692
MIRT731893	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	28347692
MIRT731893	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	28347692
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT942273	hsa-miR-130a	CLIP-seq
MIRT942274	hsa-miR-130b	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT942276	hsa-miR-1912	CLIP-seq
MIRT942277	hsa-miR-19a	CLIP-seq
MIRT942278	hsa-miR-19b	CLIP-seq
MIRT942279	hsa-miR-21	CLIP-seq
MIRT942280	hsa-miR-301a	CLIP-seq
MIRT942281	hsa-miR-301b	CLIP-seq
MIRT942282	hsa-miR-330-3p	CLIP-seq
MIRT942283	hsa-miR-3666	CLIP-seq
MIRT942284	hsa-miR-3713	CLIP-seq
MIRT942285	hsa-miR-3923	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT942287	hsa-miR-4295	CLIP-seq
MIRT942288	hsa-miR-4426	CLIP-seq
MIRT942289	hsa-miR-4528	CLIP-seq
MIRT942290	hsa-miR-454	CLIP-seq
MIRT942291	hsa-miR-4647	CLIP-seq
MIRT942292	hsa-miR-4662b	CLIP-seq
MIRT942293	hsa-miR-4671-3p	CLIP-seq
MIRT942294	hsa-miR-4694-3p	CLIP-seq
MIRT942295	hsa-miR-4775	CLIP-seq
MIRT942296	hsa-miR-515-5p	CLIP-seq
MIRT942297	hsa-miR-586	CLIP-seq
MIRT942298	hsa-miR-590-5p	CLIP-seq
MIRT942299	hsa-miR-607	CLIP-seq
MIRT942300	hsa-miR-640	CLIP-seq
MIRT942301	hsa-miR-711	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT942303	hsa-miR-3149	CLIP-seq
MIRT942304	hsa-miR-34a	CLIP-seq
MIRT942305	hsa-miR-34c-5p	CLIP-seq
MIRT942306	hsa-miR-3620	CLIP-seq
MIRT942307	hsa-miR-3913-3p	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT942308	hsa-miR-4326	CLIP-seq
MIRT942309	hsa-miR-4433	CLIP-seq
MIRT942310	hsa-miR-4438	CLIP-seq
MIRT942311	hsa-miR-4468	CLIP-seq
MIRT942312	hsa-miR-449a	CLIP-seq
MIRT942313	hsa-miR-449b	CLIP-seq
MIRT942314	hsa-miR-4672	CLIP-seq
MIRT942315	hsa-miR-4676-5p	CLIP-seq
MIRT942316	hsa-miR-4710	CLIP-seq
MIRT942317	hsa-miR-4720-3p	CLIP-seq
MIRT942318	hsa-miR-4738-3p	CLIP-seq
MIRT942319	hsa-miR-4740-3p	CLIP-seq
MIRT942295	hsa-miR-4775	CLIP-seq
MIRT942320	hsa-miR-4787-3p	CLIP-seq
MIRT942321	hsa-miR-4790-3p	CLIP-seq
MIRT942322	hsa-miR-4792	CLIP-seq
MIRT942323	hsa-miR-4804-3p	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT942325	hsa-miR-489	CLIP-seq
MIRT942326	hsa-miR-5095	CLIP-seq
MIRT942327	hsa-miR-514	CLIP-seq
MIRT942328	hsa-miR-514b-3p	CLIP-seq
MIRT942329	hsa-miR-561	CLIP-seq
MIRT942330	hsa-miR-575	CLIP-seq
MIRT942331	hsa-miR-590-3p	CLIP-seq
MIRT942332	hsa-miR-595	CLIP-seq
MIRT942300	hsa-miR-640	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT942333	hsa-miR-1976	CLIP-seq
MIRT942334	hsa-miR-2052	CLIP-seq
MIRT942335	hsa-miR-2682	CLIP-seq
MIRT942336	hsa-miR-3591-5p	CLIP-seq
MIRT942306	hsa-miR-3620	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT942337	hsa-miR-4279	CLIP-seq
MIRT942338	hsa-miR-449c	CLIP-seq
MIRT942339	hsa-miR-451b	CLIP-seq
MIRT942340	hsa-miR-4722-3p	CLIP-seq
MIRT942319	hsa-miR-4740-3p	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT942341	hsa-miR-510	CLIP-seq
MIRT942342	hsa-miR-512-5p	CLIP-seq
MIRT942343	hsa-miR-616	CLIP-seq
MIRT942344	hsa-miR-627	CLIP-seq
MIRT942300	hsa-miR-640	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT942345	hsa-miR-940	CLIP-seq
MIRT1978988	hsa-miR-3973	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT942331	hsa-miR-590-3p	CLIP-seq
MIRT942343	hsa-miR-616	CLIP-seq
MIRT942314	hsa-miR-4672	CLIP-seq
MIRT942295	hsa-miR-4775	CLIP-seq
MIRT2214129	hsa-miR-499a-5p	CLIP-seq
MIRT2214130	hsa-miR-122	CLIP-seq
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT942273	hsa-miR-130a	CLIP-seq
MIRT942274	hsa-miR-130b	CLIP-seq
MIRT2214131	hsa-miR-136	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT2214132	hsa-miR-183	CLIP-seq
MIRT942280	hsa-miR-301a	CLIP-seq
MIRT942281	hsa-miR-301b	CLIP-seq
MIRT2214133	hsa-miR-3074-5p	CLIP-seq
MIRT2214134	hsa-miR-3135b	CLIP-seq
MIRT2214135	hsa-miR-3160-5p	CLIP-seq
MIRT2214136	hsa-miR-320e	CLIP-seq
MIRT2214137	hsa-miR-3651	CLIP-seq
MIRT2214138	hsa-miR-3652	CLIP-seq
MIRT2214139	hsa-miR-3663-5p	CLIP-seq
MIRT942283	hsa-miR-3666	CLIP-seq
MIRT2214140	hsa-miR-370	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT942287	hsa-miR-4295	CLIP-seq
MIRT2214141	hsa-miR-4423-5p	CLIP-seq
MIRT2214142	hsa-miR-4430	CLIP-seq
MIRT942311	hsa-miR-4468	CLIP-seq
MIRT2214143	hsa-miR-4480	CLIP-seq
MIRT942290	hsa-miR-454	CLIP-seq
MIRT942314	hsa-miR-4672	CLIP-seq
MIRT942315	hsa-miR-4676-5p	CLIP-seq
MIRT2214144	hsa-miR-4716-5p	CLIP-seq
MIRT2214145	hsa-miR-4781-3p	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT942296	hsa-miR-515-5p	CLIP-seq
MIRT2214146	hsa-miR-564	CLIP-seq
MIRT942330	hsa-miR-575	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT942310	hsa-miR-4438	CLIP-seq
MIRT942326	hsa-miR-5095	CLIP-seq
MIRT2518434	hsa-miR-106a	CLIP-seq
MIRT2518435	hsa-miR-106b	CLIP-seq
MIRT2518436	hsa-miR-1227	CLIP-seq
MIRT2518437	hsa-miR-1234	CLIP-seq
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT2518438	hsa-miR-1262	CLIP-seq
MIRT2518439	hsa-miR-1278	CLIP-seq
MIRT2518440	hsa-miR-129-5p	CLIP-seq
MIRT2518441	hsa-miR-1303	CLIP-seq
MIRT2518442	hsa-miR-1468	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT2518443	hsa-miR-17	CLIP-seq
MIRT2518444	hsa-miR-20a	CLIP-seq
MIRT2518445	hsa-miR-20b	CLIP-seq
MIRT2518446	hsa-miR-2276	CLIP-seq
MIRT2518447	hsa-miR-302a	CLIP-seq
MIRT2518448	hsa-miR-302b	CLIP-seq
MIRT2518449	hsa-miR-302c	CLIP-seq
MIRT2518450	hsa-miR-302d	CLIP-seq
MIRT2518451	hsa-miR-302e	CLIP-seq
MIRT2518452	hsa-miR-3065-5p	CLIP-seq
MIRT2518453	hsa-miR-3119	CLIP-seq
MIRT2518454	hsa-miR-3124-3p	CLIP-seq
MIRT942303	hsa-miR-3149	CLIP-seq
MIRT2518455	hsa-miR-3152-5p	CLIP-seq
MIRT2518456	hsa-miR-3153	CLIP-seq
MIRT2518457	hsa-miR-3167	CLIP-seq
MIRT2518458	hsa-miR-3171	CLIP-seq
MIRT2518459	hsa-miR-3189-3p	CLIP-seq
MIRT2518460	hsa-miR-3613-5p	CLIP-seq
MIRT2518461	hsa-miR-3673	CLIP-seq
MIRT2518462	hsa-miR-372	CLIP-seq
MIRT2518463	hsa-miR-373	CLIP-seq
MIRT942307	hsa-miR-3913-3p	CLIP-seq
MIRT2518464	hsa-miR-3925-3p	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT2518465	hsa-miR-411	CLIP-seq
MIRT2518466	hsa-miR-4263	CLIP-seq
MIRT2518467	hsa-miR-4268	CLIP-seq
MIRT942308	hsa-miR-4326	CLIP-seq
MIRT2518468	hsa-miR-4328	CLIP-seq
MIRT942310	hsa-miR-4438	CLIP-seq
MIRT2518469	hsa-miR-4455	CLIP-seq
MIRT2518470	hsa-miR-4457	CLIP-seq
MIRT2518471	hsa-miR-4476	CLIP-seq
MIRT2518472	hsa-miR-4477b	CLIP-seq
MIRT2518473	hsa-miR-4489	CLIP-seq
MIRT2518474	hsa-miR-4508	CLIP-seq
MIRT942339	hsa-miR-451b	CLIP-seq
MIRT2518475	hsa-miR-4646-5p	CLIP-seq
MIRT2518476	hsa-miR-4661-5p	CLIP-seq
MIRT2518477	hsa-miR-4668-5p	CLIP-seq
MIRT2518478	hsa-miR-4686	CLIP-seq
MIRT2518479	hsa-miR-4691-5p	CLIP-seq
MIRT2518480	hsa-miR-4701-3p	CLIP-seq
MIRT942316	hsa-miR-4710	CLIP-seq
MIRT2518481	hsa-miR-4712-5p	CLIP-seq
MIRT2518482	hsa-miR-4715-3p	CLIP-seq
MIRT2518483	hsa-miR-4729	CLIP-seq
MIRT2518484	hsa-miR-4731-5p	CLIP-seq
MIRT2518485	hsa-miR-4753-3p	CLIP-seq
MIRT2518486	hsa-miR-4768-5p	CLIP-seq
MIRT2518487	hsa-miR-4772-3p	CLIP-seq
MIRT942322	hsa-miR-4792	CLIP-seq
MIRT2518488	hsa-miR-4795-3p	CLIP-seq
MIRT2518489	hsa-miR-4796-5p	CLIP-seq
MIRT2518490	hsa-miR-483-5p	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT942325	hsa-miR-489	CLIP-seq
MIRT2214129	hsa-miR-499a-5p	CLIP-seq
MIRT942326	hsa-miR-5095	CLIP-seq
MIRT2518491	hsa-miR-512-3p	CLIP-seq
MIRT2518492	hsa-miR-513b	CLIP-seq
MIRT2518493	hsa-miR-519a	CLIP-seq
MIRT2518494	hsa-miR-519b-3p	CLIP-seq
MIRT2518495	hsa-miR-519c-3p	CLIP-seq
MIRT2518496	hsa-miR-519d	CLIP-seq
MIRT2518497	hsa-miR-520a-3p	CLIP-seq
MIRT2518498	hsa-miR-520b	CLIP-seq
MIRT2518499	hsa-miR-520c-3p	CLIP-seq
MIRT2518500	hsa-miR-520d-3p	CLIP-seq
MIRT2518501	hsa-miR-520d-5p	CLIP-seq
MIRT2518502	hsa-miR-520e	CLIP-seq
MIRT2518503	hsa-miR-520g	CLIP-seq
MIRT2518504	hsa-miR-520h	CLIP-seq
MIRT2518505	hsa-miR-524-5p	CLIP-seq
MIRT2518506	hsa-miR-544	CLIP-seq
MIRT2518507	hsa-miR-548a-5p	CLIP-seq
MIRT2518508	hsa-miR-548ab	CLIP-seq
MIRT2518509	hsa-miR-548ak	CLIP-seq
MIRT2518510	hsa-miR-548b-5p	CLIP-seq
MIRT2518511	hsa-miR-548c-5p	CLIP-seq
MIRT2518512	hsa-miR-548d-5p	CLIP-seq
MIRT2518513	hsa-miR-548h	CLIP-seq
MIRT2518514	hsa-miR-548i	CLIP-seq
MIRT2518515	hsa-miR-548j	CLIP-seq
MIRT2518516	hsa-miR-548n	CLIP-seq
MIRT2518517	hsa-miR-548w	CLIP-seq
MIRT2518518	hsa-miR-548y	CLIP-seq
MIRT2518519	hsa-miR-559	CLIP-seq
MIRT2518520	hsa-miR-576-3p	CLIP-seq
MIRT2518521	hsa-miR-576-5p	CLIP-seq
MIRT2518522	hsa-miR-578	CLIP-seq
MIRT942332	hsa-miR-595	CLIP-seq
MIRT2518523	hsa-miR-609	CLIP-seq
MIRT942300	hsa-miR-640	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT2518524	hsa-miR-770-5p	CLIP-seq
MIRT2518525	hsa-miR-876-5p	CLIP-seq
MIRT2518526	hsa-miR-889	CLIP-seq
MIRT2518527	hsa-miR-93	CLIP-seq
MIRT2518434	hsa-miR-106a	CLIP-seq
MIRT2518435	hsa-miR-106b	CLIP-seq
MIRT2518436	hsa-miR-1227	CLIP-seq
MIRT2518437	hsa-miR-1234	CLIP-seq
MIRT942272	hsa-miR-125a-3p	CLIP-seq
MIRT2518438	hsa-miR-1262	CLIP-seq
MIRT2679363	hsa-miR-127-5p	CLIP-seq
MIRT2518439	hsa-miR-1278	CLIP-seq
MIRT2679364	hsa-miR-1279	CLIP-seq
MIRT2518440	hsa-miR-129-5p	CLIP-seq
MIRT2518441	hsa-miR-1303	CLIP-seq
MIRT2214131	hsa-miR-136	CLIP-seq
MIRT2518442	hsa-miR-1468	CLIP-seq
MIRT942275	hsa-miR-150	CLIP-seq
MIRT2518443	hsa-miR-17	CLIP-seq
MIRT2518444	hsa-miR-20a	CLIP-seq
MIRT2518445	hsa-miR-20b	CLIP-seq
MIRT2518446	hsa-miR-2276	CLIP-seq
MIRT2518447	hsa-miR-302a	CLIP-seq
MIRT2518448	hsa-miR-302b	CLIP-seq
MIRT2518449	hsa-miR-302c	CLIP-seq
MIRT2518450	hsa-miR-302d	CLIP-seq
MIRT2518451	hsa-miR-302e	CLIP-seq
MIRT2518452	hsa-miR-3065-5p	CLIP-seq
MIRT2518453	hsa-miR-3119	CLIP-seq
MIRT2518454	hsa-miR-3124-3p	CLIP-seq
MIRT2679365	hsa-miR-3143	CLIP-seq
MIRT942303	hsa-miR-3149	CLIP-seq
MIRT2518455	hsa-miR-3152-5p	CLIP-seq
MIRT2518456	hsa-miR-3153	CLIP-seq
MIRT2518457	hsa-miR-3167	CLIP-seq
MIRT2518458	hsa-miR-3171	CLIP-seq
MIRT2518459	hsa-miR-3189-3p	CLIP-seq
MIRT2518460	hsa-miR-3613-5p	CLIP-seq
MIRT2518461	hsa-miR-3673	CLIP-seq
MIRT2518462	hsa-miR-372	CLIP-seq
MIRT2518463	hsa-miR-373	CLIP-seq
MIRT942307	hsa-miR-3913-3p	CLIP-seq
MIRT2518464	hsa-miR-3925-3p	CLIP-seq
MIRT942286	hsa-miR-3934	CLIP-seq
MIRT2518465	hsa-miR-411	CLIP-seq
MIRT2518466	hsa-miR-4263	CLIP-seq
MIRT2518467	hsa-miR-4268	CLIP-seq
MIRT942308	hsa-miR-4326	CLIP-seq
MIRT2518468	hsa-miR-4328	CLIP-seq
MIRT942310	hsa-miR-4438	CLIP-seq
MIRT2679366	hsa-miR-4446-5p	CLIP-seq
MIRT2518469	hsa-miR-4455	CLIP-seq
MIRT2518470	hsa-miR-4457	CLIP-seq
MIRT2518471	hsa-miR-4476	CLIP-seq
MIRT2518472	hsa-miR-4477b	CLIP-seq
MIRT2518473	hsa-miR-4489	CLIP-seq
MIRT2518474	hsa-miR-4508	CLIP-seq
MIRT942339	hsa-miR-451b	CLIP-seq
MIRT2518475	hsa-miR-4646-5p	CLIP-seq
MIRT2518476	hsa-miR-4661-5p	CLIP-seq
MIRT2518477	hsa-miR-4668-5p	CLIP-seq
MIRT2518478	hsa-miR-4686	CLIP-seq
MIRT2518479	hsa-miR-4691-5p	CLIP-seq
MIRT2518480	hsa-miR-4701-3p	CLIP-seq
MIRT942316	hsa-miR-4710	CLIP-seq
MIRT2518481	hsa-miR-4712-5p	CLIP-seq
MIRT2518482	hsa-miR-4715-3p	CLIP-seq
MIRT2518483	hsa-miR-4729	CLIP-seq
MIRT2518484	hsa-miR-4731-5p	CLIP-seq
MIRT2518485	hsa-miR-4753-3p	CLIP-seq
MIRT2679367	hsa-miR-4755-5p	CLIP-seq
MIRT2518486	hsa-miR-4768-5p	CLIP-seq
MIRT2518487	hsa-miR-4772-3p	CLIP-seq
MIRT942322	hsa-miR-4792	CLIP-seq
MIRT2518488	hsa-miR-4795-3p	CLIP-seq
MIRT2518489	hsa-miR-4796-5p	CLIP-seq
MIRT2679368	hsa-miR-4803	CLIP-seq
MIRT2518490	hsa-miR-483-5p	CLIP-seq
MIRT942324	hsa-miR-485-3p	CLIP-seq
MIRT2214129	hsa-miR-499a-5p	CLIP-seq
MIRT942326	hsa-miR-5095	CLIP-seq
MIRT2679369	hsa-miR-511	CLIP-seq
MIRT2518491	hsa-miR-512-3p	CLIP-seq
MIRT2518492	hsa-miR-513b	CLIP-seq
MIRT942296	hsa-miR-515-5p	CLIP-seq
MIRT2518493	hsa-miR-519a	CLIP-seq
MIRT2518494	hsa-miR-519b-3p	CLIP-seq
MIRT2518495	hsa-miR-519c-3p	CLIP-seq
MIRT2518496	hsa-miR-519d	CLIP-seq
MIRT2518497	hsa-miR-520a-3p	CLIP-seq
MIRT2518498	hsa-miR-520b	CLIP-seq
MIRT2518499	hsa-miR-520c-3p	CLIP-seq
MIRT2518500	hsa-miR-520d-3p	CLIP-seq
MIRT2518501	hsa-miR-520d-5p	CLIP-seq
MIRT2518502	hsa-miR-520e	CLIP-seq
MIRT2518503	hsa-miR-520g	CLIP-seq
MIRT2518504	hsa-miR-520h	CLIP-seq
MIRT2518505	hsa-miR-524-5p	CLIP-seq
MIRT2518506	hsa-miR-544	CLIP-seq
MIRT2518507	hsa-miR-548a-5p	CLIP-seq
MIRT2518508	hsa-miR-548ab	CLIP-seq
MIRT2518509	hsa-miR-548ak	CLIP-seq
MIRT2518510	hsa-miR-548b-5p	CLIP-seq
MIRT2518511	hsa-miR-548c-5p	CLIP-seq
MIRT2518512	hsa-miR-548d-5p	CLIP-seq
MIRT2518513	hsa-miR-548h	CLIP-seq
MIRT2518514	hsa-miR-548i	CLIP-seq
MIRT2518515	hsa-miR-548j	CLIP-seq
MIRT2518516	hsa-miR-548n	CLIP-seq
MIRT2679370	hsa-miR-548p	CLIP-seq
MIRT2518517	hsa-miR-548w	CLIP-seq
MIRT2518518	hsa-miR-548y	CLIP-seq
MIRT2518519	hsa-miR-559	CLIP-seq
MIRT2679371	hsa-miR-562	CLIP-seq
MIRT2518520	hsa-miR-576-3p	CLIP-seq
MIRT2518521	hsa-miR-576-5p	CLIP-seq
MIRT2518522	hsa-miR-578	CLIP-seq
MIRT942332	hsa-miR-595	CLIP-seq
MIRT2518523	hsa-miR-609	CLIP-seq
MIRT942300	hsa-miR-640	CLIP-seq
MIRT2679372	hsa-miR-664	CLIP-seq
MIRT2679373	hsa-miR-670	CLIP-seq
MIRT942302	hsa-miR-764	CLIP-seq
MIRT2518524	hsa-miR-770-5p	CLIP-seq
MIRT2518525	hsa-miR-876-5p	CLIP-seq
MIRT2518526	hsa-miR-889	CLIP-seq
MIRT2518527	hsa-miR-93	CLIP-seq

Show/Hide all (98)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000266	Process	Mitochondrial fission	IBA
GO:0000266	Process	Mitochondrial fission	IDA	20850011, 23530241
GO:0000266	Process	Mitochondrial fission	IEA
GO:0000266	Process	Mitochondrial fission	IMP	23349293
GO:0000266	Process	Mitochondrial fission	IMP	18353969, 21149567, 22265414, 23921378, 26992161, 27145208, 32484300
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	22265414, 23530241
GO:0003924	Function	GTPase activity	IEA
GO:0005096	Function	GTPase activator activity	IC	25767741
GO:0005515	Function	Protein binding	IPI	9731200, 12861026, 18838687, 19638400, 21149567, 21217774, 21508961, 21701560, 21822277, 22228096, 22367970, 22639965, 23283981, 23813973, 24282027, 24550280, 26358295, 26618722, 27059175, 29464060, 29541021, 30914652, 31046837, 32814053
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12618434, 21149567, 23349293
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	28969390
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	11514614, 21822277, 22265414, 23349293, 23530241, 23921378, 24599962, 26618722, 29307555
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IMP	28969390
GO:0005741	Component	Mitochondrial outer membrane	IDA	21149567, 26122121, 27145208
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005777	Component	Peroxisome	IDA	12618434
GO:0005777	Component	Peroxisome	IEA
GO:0005777	Component	Peroxisome	IMP	23921378
GO:0005783	Component	Endoplasmic reticulum	IDA	11514614
GO:0005783	Component	Endoplasmic reticulum	IDA	9472031
GO:0005789	Component	Endoplasmic reticulum membrane	TAS	25767741
GO:0005794	Component	Golgi apparatus	IDA	20688057
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA	22265414, 23921378
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	IMP	11514614
GO:0005829	Component	Cytosol	TAS
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IDA	9472031
GO:0005874	Component	Microtubule	IDA	21525035
GO:0005903	Component	Brush border	IEA
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007005	Process	Mitochondrion organization	IMP	21149567
GO:0007005	Process	Mitochondrion organization	IMP	11514614
GO:0007029	Process	Endoplasmic reticulum organization	IMP	11514614
GO:0008017	Function	Microtubule binding	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010821	Process	Regulation of mitochondrion organization	IEA
GO:0012501	Process	Programmed cell death	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016559	Process	Peroxisome fission	IBA
GO:0016559	Process	Peroxisome fission	IDA	12618434
GO:0016559	Process	Peroxisome fission	IEA
GO:0016559	Process	Peroxisome fission	IMP	18353969, 23921378
GO:0016787	Function	Hydrolase activity	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030742	Function	GTP-dependent protein binding	IDA	25767741
GO:0031267	Function	Small GTPase binding	IDA	25767741
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	16874301, 19407830
GO:0032991	Component	Protein-containing complex	IDA	17408615, 18353969
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	18353969, 20850011, 21701560, 23584531, 29899447, 30914652
GO:0042803	Function	Protein homodimerization activity	IDA	22265414, 23530241
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IBA
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IEA
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IMP	12499352
GO:0045202	Component	Synapse	IEA
GO:0048312	Process	Intracellular distribution of mitochondria	IBA
GO:0048312	Process	Intracellular distribution of mitochondria	IEA
GO:0048312	Process	Intracellular distribution of mitochondria	IMP	11514614
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	9472031, 9570752
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050714	Process	Positive regulation of protein secretion	IDA	9570752
GO:0051259	Process	Protein complex oligomerization	IMP	27145208
GO:0060047	Process	Heart contraction	IEA
GO:0070585	Process	Protein localization to mitochondrion	IEA
GO:0070585	Process	Protein localization to mitochondrion	IMP	23584531
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IMP	28388446
GO:0090141	Process	Positive regulation of mitochondrial fission	IEA
GO:0090141	Process	Positive regulation of mitochondrial fission	IMP	19279012
GO:0090141	Process	Positive regulation of mitochondrial fission	TAS	20436456
GO:0090149	Process	Mitochondrial membrane fission	IDA	11514614
GO:0090149	Process	Mitochondrial membrane fission	IMP	21822277, 27301544, 27328748
GO:0099073	Component	Mitochondrion-derived vesicle	IDA	26618722
GO:0160040	Process	Mitocytosis	IEA
GO:1900063	Process	Regulation of peroxisome organization	IEA
GO:1901524	Process	Regulation of mitophagy	IGI	19279012
GO:1903532	Process	Positive regulation of secretion by cell	IEA
GO:1903578	Process	Regulation of ATP metabolic process	IEA

MIM	HGNC	e!Ensembl
603850	2973	ENSG00000087470

O00429

Protein name

Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1

Protein function

Functions in mitochondrial and peroxisomal division (PubMed:11514614, PubMed:12499366, PubMed:17301055, PubMed:17460227, PubMed:17553808, PubMed:18695047, PubMed:18838687, PubMed:19342591, PubMed:19411255, PubMed:19638400, PubMed:23283981, PubMe

PDB

3W6N , 3W6O , 3W6P , 4BEJ , 4H1U , 4H1V , 5WP9 , 8T1H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00350	Dynamin_N	28 → 217	Dynamin family	Domain
PF01031	Dynamin_M	226 → 510	Dynamin central region	Family
PF02212	GED	639 → 730	Dynamin GTPase effector domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed with highest levels found in skeletal muscles, heart, kidney and brain. Isoform 1 is brain-specific. Isoform 2 and isoform 3 are predominantly expressed in testis and skeletal muscles respectively. Isoform 4 is w

Sequence

MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTR
RPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISG
NNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSI
ILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG
IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDC
LPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSEL
CGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTN
EMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSAL
APASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEE
LLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRK
NIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKAL
QGASQIIAEIRETHLW

Sequence length

736

Interactions

View interactions

	KEGG		Reactome
	Necroptosis NOD-like receptor signaling pathway TNF signaling pathway		Apoptotic execution phase

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
DNM1L-related disorder	Likely pathogenic; Pathogenic	rs1316999302, rs2540980636, rs886037861	RCV004545826 RCV004545842 RCV003897583	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
DNM1L-related movement disorder	Likely pathogenic	rs2137612089	RCV001598695	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Encephalopathy, lethal, due to defective mitochondrial peroxisomal fission 1	Pathogenic; Likely pathogenic	rs2137302207, rs2137523446, rs769684495, rs201259747, rs2541080714, rs2541008031, rs121908531, rs863223953, rs2540980636, rs879253874, rs879255685, rs886037861, rs879255686, rs879255687, rs1952694899 View all (9 more)	RCV001827471 RCV001775395 RCV002507784 RCV005868536 RCV002466320 View all (21 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Mitochondrial disease	Likely pathogenic	rs1316999302, rs2137520923, rs2137612346	RCV002221285 RCV002221286 RCV002221288	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Optic atrophy 5	Likely pathogenic; Pathogenic	rs769684495, rs863223953, rs1064794656, rs1555229948, rs1555119216, rs1565548029, rs1592631789	RCV002507784 RCV000850522 RCV002248701 RCV000515453 RCV000515455 RCV000850546 RCV000850504 View all (2 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (25)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT OPTIC ATROPHY, CLASSIC FORM	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DNM1L-RELATED ENCEPHALOPATHY DUE TO MITOCHONDRIAL AND PEROXISOMAL FISSION DEFECT	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary ataxia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary spastic paraplegia 8	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIGH SYNDROME	—	ClinGen, ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lethal Encephalopathy	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROCEPHALY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL ENCEPHALOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL MYOPATHY AND SIDEROBLASTIC ANEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY, LACTIC ACIDOSIS, AND SIDEROBLASTIC ANEMIA 2	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
OPTIC ATROPHY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC ATROPHY 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal dystrophy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPASTIC PARAPLEGIA 8, AUTOSOMAL DOMINANT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (256)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acidosis Lactic	Lactic acidosis	Pubtator	27328748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19525928, 31417649, 31770286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10749171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	26812016		★★★★★ ★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	30940726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18599615, 30171839	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24252614, 26122121, 32216003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27677309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23713734, 29335339, 30515821, 31019453, 31450774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Macrocytic	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27737949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30317624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10749171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	27831567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27737949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	37315759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy of corpus callosum	Atrophy Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy/Degeneration affecting the brainstem	Brainstem Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant optic atrophy, classic form	Optic Atrophy	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30339249, 30867720, 30940514		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	17682056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26604000, 30850373, 31475481, 34573276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	24758576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	29386996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10749171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23128392, 25434519, 25595902, 27746856, 29072687, 30425235, 30809096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23128392	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27746856, 35440104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31770286, 37344480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38238834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23028930, 29175207, 29329364, 31417649, 31770286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32448194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27509055, 31409904, 31639424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28623750, 30604255, 30993599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27923790, 37086582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28623750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28607103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	CLINVAR_DG	26604000, 27145208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	30767894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29435096, 30148677, 30447185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30093535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17682056, 28139514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31237014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	32241273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22487795, 29329364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Color Blindness, Blue	Color blindness	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30258050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24905188, 26915633, 28384228, 30425165, 30567380, 30938090, 31024341, 31811407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	21453958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	21453958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	29223396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	30850373, 31475481, 32012656, 35914810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28173848, 29768513, 29924999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28173848, 29768513, 29924999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29969317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31849103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25853493, 31063459, 31349216		★★★★★ ★☆☆☆☆ Found in Text Mining only
DNM1L-related encephalopathy due to mitochondrial and peroxisomal fission defect	Encephalopathy	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down Syndrome	BEFREE	28939434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane Retraction Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	BEFREE	31587467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	31064654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	21453958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	26604000, 26931468, 27145208, 27328748, 30767894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ENCEPHALOPATHY, LETHAL, DUE TO DEFECTIVE MITOCHONDRIAL AND PEROXISOMAL FISSION	Encephalopathy	ORPHANET_DG	17460227		★★★★★ ★☆☆☆☆ Found in Text Mining only
ENCEPHALOPATHY, LETHAL, DUE TO DEFECTIVE MITOCHONDRIAL AND PEROXISOMAL FISSION	Encephalopathy	GENOMICS_ENGLAND_DG	17460227, 26825290, 27145208, 27604308		★★★★★ ★☆☆☆☆ Found in Text Mining only
ENCEPHALOPATHY, LETHAL, DUE TO DEFECTIVE MITOCHONDRIAL AND PEROXISOMAL FISSION	Encephalopathy	CLINVAR_DG	17460227, 26604000, 27145208		★★★★★ ★☆☆☆☆ Found in Text Mining only
ENCEPHALOPATHY, LETHAL, DUE TO DEFECTIVE MITOCHONDRIAL AND PEROXISOMAL FISSION	Encephalopathy	UNIPROT_DG	17460227, 26604000, 26992161, 27145208, 27301544, 27328748, 29899447		★★★★★ ★☆☆☆☆ Found in Text Mining only
ENCEPHALOPATHY, LETHAL, DUE TO DEFECTIVE MITOCHONDRIAL AND PEROXISOMAL FISSION	Encephalopathy	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37344480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29448246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsia Partialis Continua	Epilepsia Partialis Continua	BEFREE	27145208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30711678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	30711678, 31475481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	BEFREE	27145208, 30801875, 30939602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27509055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30501006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30501006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	30501006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30501006	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	30171839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	31029786		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	31029786		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	31029786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	31361992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	30127972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized myoclonic seizures	Myoclonic Seizures	CLINVAR_DG	26604000, 27145208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized tonic-clonic seizures with focal onset	Bilateral convulsive seizures	CLINVAR_DG	26604000, 27145208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	26247724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24899388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37660127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24899388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27495873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35697672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	31587467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	30566949	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28350990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35914810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24905188, 26915633, 28384228, 30425165, 30567380, 30938090, 31024341, 31811407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37086582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	27170313, 29726929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	30290401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	BEFREE	31475481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	Pubtator	31475481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Horizontal Nystagmus	Horizontal nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	21257639, 26122121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21336284, 23641925, 24681059, 25273056, 29397067, 30449600, 30515821, 30914652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18805504, 28383775, 28808422, 29654945, 30444033, 30447185, 31115753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29563985, 29981304, 31346611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28190775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	32728162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19525928	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28590414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	22511751, 28739174, 29431643, 30042687, 31336911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28294974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28294974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22367970, 28432138, 29464060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	37817199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	29725013, 29906559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28634116, 29435096, 30093535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27349577, 28423497, 29890853, 31822044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	28063983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27124102, 27542250, 29210177, 30143522, 30894684, 31322265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29669222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23792636, 32767829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31770286	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34299244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23128392	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23128392, 25434519, 25595902, 27746856, 29072687, 30425235, 30809096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30501006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30143522, 30981110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23028930, 29175207, 29329364, 31417649, 31770286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31409904, 31639424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25658205, 31412251, 31674061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21724752, 31838085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28965855, 30940726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19525928, 21527248, 27509055, 28818497, 29290987, 29329364, 29466320, 30143522, 31127452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22487795, 29329364		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25174275, 30185782, 30916813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30185782, 40141318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	30566949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10749171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	CTD_human_DG	17460227		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Microcephaly	BEFREE	26992161		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microlissencephaly	Microlissencephaly	CTD_human_DG	17460227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	18599615, 22773688, 23028930, 24080278, 24252614, 26122121, 27328748, 28040727, 30501006, 33586027, 35368865, 37141173, 37315759, 37344480	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	27328748, 30767894, 31587467		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Encephalomyopathies	Mitochondrial encephalomyopathy	CTD_human_DG	17460227		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial encephalopathy	Mitochondrial encephalopathy	BEFREE	31587467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Morning glory anomaly	Morning glory anomaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28238799, 31377418, 31450774		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	29725013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	29725013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29245958, 30425163, 30425165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	28131843		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28435473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23957735, 25595902, 25658205, 26356820, 26530043, 27542250, 27889261, 28606997, 28818497, 29137373, 29329364, 29360576, 29898993, 29993201, 30127972 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30566949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	30566949	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	27328748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27830583, 30801875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26518267, 26812016, 28560384, 28591721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26518267, 26812016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	26122121, 32787872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21145355, 23641925, 27830583, 28154157, 28350990, 28379197, 28409390, 28641287, 29290987, 30285293, 30515821, 31019453, 31283035, 31450774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28981157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16103059, 28408823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus Pathologic	Nystagmus	Pubtator	30850373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31450774, 31624314		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Oculomotor apraxia	Oculomotor apraxia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculovestibuloauditory syndrome	Oculovestibuloauditory Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	16648378, 28131082, 28969390		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy	Optic Atrophy	CTD_human_DG	17460227		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy	Optic atrophy	Pubtator	30850373	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy 1	Optic Atrophy	BEFREE	16698014, 23006856, 27491814, 27660309, 27776427, 27837193, 28683400, 28761019, 28890359, 28939434, 29092894, 29241732, 29245943, 29395086, 29419407 View all (16 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy 1	Optic Atrophy	LHGDN	18488399		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Atrophy 1	Optic Atrophy	ORPHANET_DG	28969390		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC ATROPHY 5 (disorder)	Optic Atrophy	GENOMICS_ENGLAND_DG	17460227		★★★★★ ★☆☆☆☆ Found in Text Mining only
OPTIC ATROPHY 5 (disorder)	Optic Atrophy	CLINVAR_DG	27145208		★★★★★ ★☆☆☆☆ Found in Text Mining only
OPTIC ATROPHY 5 (disorder)	Optic Atrophy	UNIPROT_DG	28969390		★★★★★ ★☆☆☆☆ Found in Text Mining only
OPTIC ATROPHY 5 (disorder)	Optic Atrophy	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy Autosomal Dominant	Optic atrophy	Pubtator	16648378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
OPTIC ATROPHY WITH OR WITHOUT DEAFNESS, OPHTHALMOPLEGIA, MYOPATHY, ATAXIA, AND NEUROPATHY	Optic Atrophy With Or Without Deafness, Ophthalmoplegia, Myopathy, Ataxia, And Neuropathy	BEFREE	22776096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30691497		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31409904, 31639424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32448194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25658205, 31412251, 31674061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31412251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20164189, 20463395, 21292769, 21615675, 22398207, 22428580, 23813973, 25482923, 27267045, 27619562, 28040727, 28215578, 28531191, 30515821, 31308800 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	22428580, 26122121, 28040727	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	28215578		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	BEFREE	31389613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peroxisomal Disorders	Peroxisomal disorder	Pubtator	27328748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	26812016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	35368865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	27831567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21724752, 31838085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21724752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29329364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30042687, 31336911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33450375	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	37442283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	25239563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25284615, 26119034, 28294974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31825802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29704468, 29890853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	31285421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31755231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	30850373, 35914810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorimotor neuropathy	Sensorimotor neuropathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29336470, 30380511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Congenital Microcephaly	Congenital Microcephaly	CTD_human_DG	17460227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	30096906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28818497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	20489733, 21292769, 24176854, 24610934, 26518267, 26813789, 27923790, 28040727, 28450286, 29725013, 30158296, 33146568, 34573276, 36613786, 37442283, 38084427 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	24080278, 26093086	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SPASTIC ATAXIA, CHARLEVOIX-SAGUENAY TYPE	Spastic Ataxia	BEFREE	27288452, 28527629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23957735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30501006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37198593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28818497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28606997, 31127452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CLINVAR_DG	26604000, 27145208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28153522, 28479396, 28919853, 29877124, 30939602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31282064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28965855, 30940726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28210956, 28579326, 30084007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	28173111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Temporal pallor of optic disc	Temporal Pallor Of Optic Disc	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31138329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35669725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	27923790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29924999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	37315759	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

DNM1L (dynamin 1 like)