Gene Gene information from NCBI Gene database.
Entrez ID 10058
Gene name ATP binding cassette subfamily B member 6 (LAN blood group)
Gene symbol ABCB6
Synonyms (NCBI Gene)
ABCLANMTABC3PRPumat
Chromosome 2
Chromosome location 2q35
Summary This gene encodes a member of the ATP-binding cassette (ABC) transporter superfamily. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the heavy metal importer subfamily and plays a role in p
SNPs SNP information provided by dbSNP.
16
SNP ID Visualize variation Clinical significance Consequence
rs148211042 C>T Pathogenic Missense variant, coding sequence variant
rs148458820 C>T Affects Coding sequence variant, stop gained
rs149202834 G>A Affects Missense variant, coding sequence variant, intron variant
rs376664522 G>A Affects Coding sequence variant, stop gained
rs387906908 AT>- Affects Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
18
miRTarBase ID miRNA Experiments Reference
MIRT023567 hsa-miR-1-3p Proteomics 18668040
MIRT029048 hsa-miR-26b-5p Microarray 19088304
MIRT531711 hsa-miR-7113-5p PAR-CLIP 22012620
MIRT531711 hsa-miR-7113-5p PAR-CLIP 22012620
MIRT1923590 hsa-miR-3677-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
79
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000166 Function Nucleotide binding IEA
GO:0005524 Function ATP binding IDA 10837493, 27507172
GO:0005524 Function ATP binding IEA
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605452 47 ENSG00000115657
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NP58
Protein name ATP-binding cassette sub-family B member 6 (ABC-type heme transporter ABCB6) (EC 7.6.2.5) (Mitochondrial ABC transporter 3) (Mt-ABC transporter 3) (P-glycoprotein-related protein) (Ubiquitously-expressed mammalian ABC half transporter)
Protein function ATP-dependent transporter that catalyzes the transport of a broad-spectrum of porphyrins from the cytoplasm to the extracellular space through the plasma membrane or into the vesicle lumen (PubMed:17661442, PubMed:23792964, PubMed:27507172, PubM
PDB 3NH6 , 3NH9 , 3NHA , 3NHB , 7D7N , 7D7R , 7DNY , 7DNZ , 7EKL , 7EKM , 8FWK , 8K7B , 8K7C , 8YR3 , 8YR4 , 9DBQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16185 MTABC_N 6 255 Mitochondrial ABC-transporter N-terminal five TM region Family
PF00664 ABC_membrane 265 544 ABC transporter transmembrane region Family
PF00005 ABC_tran 606 755 ABC transporter Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. High expression is detected in the retinal epithelium (PubMed:10837493, PubMed:22226084). Expressed in mature erythrocytes (PubMed:22655043). {ECO:0000269|PubMed:10837493, ECO:0000269|PubMed:22226084, ECO:0000269|PubM
Sequence
MVTVGNYCEAEGPVGPAWMQDGLSPCFFFTLVPSTRMALGTLALVLALPCRRRERPAGAD
SLSWGAGPRISPYVLQLLLATLQAALPLAGLAGRVGTARGAPLPSYLLLASVLESLAGAC
GLWLLVVERSQARQRLAMGIWIKFRHSPGLLLLWTVAFAAENLALVSWNSPQWWWARADL
GQQVQFSLWVLRYVVSGGLFVLGLWAPGLRPQSYTLQVHEEDQDVERSQVRSAAQQSTWR
DFGRKLRLLSGYLWP
RGSPALQLVVLICLGLMGLERALNVLVPIFYRNIVNLLTEKAPWN
SLAWTVTSYVFLKFLQGGGTGSTGFVSNLRTFLWIRVQQFTSRRVELLIFSHLHELSLRW
HLGRRTGEVLRIADRGTSSVTGLLSYLVFNVIPTLADIIIGIIYFSMFFNAWFGLIVFLC
MSLYLTLTIVVTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI
IKYQGLEWKSSASLVLLNQTQNLVIGLGLLAGSLLCAYFVTEQKLQVGDYVLFGTYIIQL
YMPL
NWFGTYYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYA
DGRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFRFYDISSGCIRIDGQDISQVTQA
SLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGNDEVEAAAQAAGIHDAIMAFPEGYRTQV
GERGLKLSGGEKQRVAIARTILKAPGIILLDEATS
ALDTSNERAIQASLAKVCANRTTIV
VAHRLSTVVNADQILVIKDGCIVERGRHEALLSRGGVYADMWQLQQGQEETSEDTKPQTM
ER
Sequence length 842
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  ABC transporters   Mitochondrial ABC transporters
Defective ABCB6 causes isolated colobomatous microphthalmia 7 (MCOPCB7)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
35
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Dyschromatosis universalis hereditaria 3 Pathogenic; Likely pathogenic rs796065353, rs764893806, rs201100181, rs397514756, rs397514757, rs397514758 RCV000190414
RCV002500635
RCV003991334
RCV000054816
RCV000054817
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial pseudohyperkalemia Pathogenic; Likely pathogenic rs754667801, rs764893806 RCV000202403
RCV000202404
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Langereis blood group Likely pathogenic rs764893806 RCV002500635
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Microphthalmia, isolated, with coloboma 7 Likely pathogenic rs764893806 RCV002500635
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ABCB6-related disorder Conflicting classifications of pathogenicity; Benign; Likely benign; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Acute intermittent porphyria Benign; Likely benign; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Ablepharon Ablepharon BEFREE 30301382
★☆☆☆☆
Found in Text Mining only
Acromegaly Acromegaly BEFREE 29767287
★☆☆☆☆
Found in Text Mining only
Actinic keratosis Actinic keratosis BEFREE 9344196
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome BEFREE 31109285
★☆☆☆☆
Found in Text Mining only
Acute Erythroblastic Leukemia Erythroblastic Leukemia BEFREE 23180570, 29990841
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 30860475
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 30639603
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 26512967
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of large intestine Colorectal Cancer BEFREE 20377486
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 11257105
★☆☆☆☆
Found in Text Mining only