Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	100532726
Gene name	NDUFC2-KCTD14 readthrough
Gene symbol	NDUFC2-KCTD14
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11q14.1
Summary	This locus represents naturally occurring read-through transcription between the neighboring NDUFC2 (NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa) and KCTD14 (potassium channel tetramerisation domain containing 14) genes on chromosome

Show/Hide all (65)

miRTarBase ID	miRNA	Experiments	Reference
MIRT494920	hsa-miR-551b-5p	PAR-CLIP	23708386
MIRT494919	hsa-miR-2115-3p	PAR-CLIP	23708386
MIRT494918	hsa-miR-6889-3p	PAR-CLIP	23708386
MIRT494917	hsa-miR-5189-3p	PAR-CLIP	23708386
MIRT494916	hsa-miR-1227-3p	PAR-CLIP	23708386
MIRT452136	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT452135	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT452134	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT452133	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT452132	hsa-miR-1266-3p	PAR-CLIP	23592263
MIRT452131	hsa-miR-643	PAR-CLIP	23592263
MIRT452130	hsa-miR-567	PAR-CLIP	23592263
MIRT452129	hsa-miR-4326	PAR-CLIP	23592263
MIRT452128	hsa-miR-376a-5p	PAR-CLIP	23592263
MIRT452127	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT452126	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT452125	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT452124	hsa-miR-4777-5p	PAR-CLIP	23592263
MIRT452123	hsa-miR-675-3p	PAR-CLIP	23592263
MIRT452122	hsa-miR-297	PAR-CLIP	23592263
MIRT452121	hsa-miR-7152-5p	PAR-CLIP	23592263
MIRT452120	hsa-miR-3149	PAR-CLIP	23592263
MIRT494920	hsa-miR-551b-5p	PAR-CLIP	23708386
MIRT494919	hsa-miR-2115-3p	PAR-CLIP	23708386
MIRT494918	hsa-miR-6889-3p	PAR-CLIP	23708386
MIRT494917	hsa-miR-5189-3p	PAR-CLIP	23708386
MIRT494916	hsa-miR-1227-3p	PAR-CLIP	23708386
MIRT452136	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT452135	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT452134	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT452133	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT452132	hsa-miR-1266-3p	PAR-CLIP	23592263
MIRT452131	hsa-miR-643	PAR-CLIP	23592263
MIRT452130	hsa-miR-567	PAR-CLIP	23592263
MIRT452129	hsa-miR-4326	PAR-CLIP	23592263
MIRT452128	hsa-miR-376a-5p	PAR-CLIP	23592263
MIRT452127	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT452126	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT452125	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT452124	hsa-miR-4777-5p	PAR-CLIP	23592263
MIRT452123	hsa-miR-675-3p	PAR-CLIP	23592263
MIRT452122	hsa-miR-297	PAR-CLIP	23592263
MIRT452121	hsa-miR-7152-5p	PAR-CLIP	23592263
MIRT452120	hsa-miR-3149	PAR-CLIP	23592263
MIRT1179149	hsa-miR-371-5p	CLIP-seq
MIRT1179150	hsa-miR-371b-5p	CLIP-seq
MIRT1179151	hsa-miR-4698	CLIP-seq
MIRT1179152	hsa-miR-499-3p	CLIP-seq
MIRT1179153	hsa-miR-499a-3p	CLIP-seq
MIRT2280916	hsa-miR-29a	CLIP-seq
MIRT2280917	hsa-miR-29b	CLIP-seq
MIRT2280918	hsa-miR-29c	CLIP-seq
MIRT2280919	hsa-miR-3152-3p	CLIP-seq
MIRT2280920	hsa-miR-3677-5p	CLIP-seq
MIRT2280921	hsa-miR-3921	CLIP-seq
MIRT2280922	hsa-miR-4642	CLIP-seq
MIRT2280923	hsa-miR-4649-3p	CLIP-seq
MIRT2280924	hsa-miR-4653-5p	CLIP-seq
MIRT2280925	hsa-miR-4694-5p	CLIP-seq
MIRT2280926	hsa-miR-4711-5p	CLIP-seq
MIRT2280919	hsa-miR-3152-3p	CLIP-seq
MIRT2280921	hsa-miR-3921	CLIP-seq
MIRT2280923	hsa-miR-4649-3p	CLIP-seq
MIRT2280924	hsa-miR-4653-5p	CLIP-seq
MIRT2280925	hsa-miR-4694-5p	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0006120	Process	Mitochondrial electron transport, NADH to ubiquinone	IEA
GO:0016020	Component	Membrane	IEA
GO:0045271	Component	Respiratory chain complex I	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

E9PQ53

Protein name

NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2 (NDUFC2-KCTD14 readthrough transcript protein)

Protein function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06374	NDUF_C2	10 → 107	NADH-ubiquinone oxidoreductase subunit b14.5b (NDUFC2)	Family

Sequence

MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ
LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDVYCCGAERRG

Sequence length

114

Interactions

View interactions

	KEGG
	Oxidative phosphorylation Metabolic pathways Thermogenesis Retrograde endocannabinoid signaling Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MITOCHONDRIAL COMPLEX I DEFICIENCY, NUCLEAR TYPE 36	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

NDUFC2-KCTD14 (NDUFC2-KCTD14 readthrough)