Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	100507436
Gene name	MHC class I polypeptide-related sequence A
Gene symbol	MICA
Synonyms (NCBI Gene)	MIC-APERB11.1
Chromosome	6
Chromosome location	6p21.33
Summary	This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglo

556

Show/Hide all (556)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001998	hcmv-miR-UL112-3p	Luciferase reporter assay	17641203
MIRT004677	hsa-miR-520b	flowLuciferase reporter assayqRT-PCR	19109132
MIRT004677	hsa-miR-520b	flowLuciferase reporter assayqRT-PCR	19109132
MIRT002551	hsa-miR-373-3p	Microarray	15685193
MIRT054070	hsa-miR-302c-3p	5.0	23820258
MIRT054070	hsa-miR-302c-3p	5.0	23820258
MIRT054070	hsa-miR-302c-3p	5.0	23820258
MIRT054070	hsa-miR-302c-3p	5.0	23820258
MIRT054070	hsa-miR-302c-3p	5.0	23820258
MIRT054074	hsa-miR-520c-3p	5.0	23820258
MIRT054074	hsa-miR-520c-3p	5.0	23820258
MIRT054074	hsa-miR-520c-3p	5.0	23820258
MIRT054074	hsa-miR-520c-3p	5.0	23820258
MIRT054074	hsa-miR-520c-3p	5.0	23820258
MIRT690585	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT690584	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT690583	hsa-miR-940	HITS-CLIP	23313552
MIRT690582	hsa-miR-3929	HITS-CLIP	23313552
MIRT690581	hsa-miR-4419b	HITS-CLIP	23313552
MIRT690580	hsa-miR-4478	HITS-CLIP	23313552
MIRT690579	hsa-miR-188-5p	HITS-CLIP	23313552
MIRT690578	hsa-miR-6866-3p	HITS-CLIP	23313552
MIRT613538	hsa-miR-665	HITS-CLIP	23313552
MIRT690577	hsa-miR-4780	HITS-CLIP	23313552
MIRT690576	hsa-miR-6780b-3p	HITS-CLIP	23313552
MIRT690575	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT449248	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT449249	hsa-miR-1827	HITS-CLIP	23313552
MIRT690574	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT690573	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT690572	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT690571	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT635073	hsa-miR-623	HITS-CLIP	23313552
MIRT690570	hsa-miR-425-3p	HITS-CLIP	23313552
MIRT690569	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT690568	hsa-miR-4293	HITS-CLIP	23313552
MIRT690567	hsa-miR-3622a-3p	HITS-CLIP	23313552
MIRT690566	hsa-miR-3622b-3p	HITS-CLIP	23313552
MIRT690565	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT690564	hsa-miR-4459	HITS-CLIP	23313552
MIRT690563	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT690562	hsa-miR-323b-3p	HITS-CLIP	23313552
MIRT690561	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT690560	hsa-miR-544b	HITS-CLIP	23313552
MIRT690559	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT690558	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT683688	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT683687	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT683686	hsa-miR-520h	HITS-CLIP	23313552
MIRT683685	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT683684	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT683683	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT683682	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT683681	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT683680	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT683679	hsa-miR-4425	HITS-CLIP	23313552
MIRT683678	hsa-miR-3147	HITS-CLIP	23313552
MIRT683677	hsa-miR-450b-3p	HITS-CLIP	23313552
MIRT683676	hsa-miR-769-3p	HITS-CLIP	23313552
MIRT683675	hsa-miR-6728-5p	HITS-CLIP	23313552
MIRT683674	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT683673	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT683672	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT678117	hsa-miR-8062	HITS-CLIP	23824327
MIRT678116	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT678115	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT678114	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT678113	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT678112	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT678111	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT678110	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT678109	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT678108	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678107	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT678106	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT678105	hsa-miR-1297	HITS-CLIP	23824327
MIRT678104	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT678103	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT678102	hsa-miR-4465	HITS-CLIP	23824327
MIRT678101	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT678100	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT661763	hsa-miR-6847-5p	HITS-CLIP	23824327
MIRT661762	hsa-miR-4257	HITS-CLIP	23824327
MIRT661761	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT661760	hsa-miR-7977	HITS-CLIP	23824327
MIRT661759	hsa-miR-3942-3p	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT625277	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625276	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT625275	hsa-miR-603	HITS-CLIP	23824327
MIRT643331	hsa-miR-548p	HITS-CLIP	23824327
MIRT635077	hsa-miR-3938	HITS-CLIP	23824327
MIRT643330	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT613539	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT635076	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT635075	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT635074	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT661758	hsa-miR-3660	HITS-CLIP	23824327
MIRT661757	hsa-miR-4526	HITS-CLIP	23824327
MIRT643329	hsa-miR-1468-3p	HITS-CLIP	23824327
MIRT625274	hsa-miR-3941	HITS-CLIP	23824327
MIRT635073	hsa-miR-623	HITS-CLIP	23824327
MIRT635072	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT635071	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT635070	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT635069	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT635068	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT635067	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT635066	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT635065	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT635064	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT643342	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT643341	hsa-miR-2392	HITS-CLIP	23824327
MIRT643334	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT643340	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT643339	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT643338	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT643337	hsa-miR-383-5p	HITS-CLIP	23824327
MIRT643336	hsa-miR-4772-5p	HITS-CLIP	23824327
MIRT643335	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT643334	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT643333	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT643332	hsa-miR-5096	HITS-CLIP	23824327
MIRT617758	hsa-miR-34a-3p	HITS-CLIP	23824327
MIRT617757	hsa-miR-3617-3p	HITS-CLIP	23824327
MIRT617756	hsa-miR-4310	HITS-CLIP	23824327
MIRT617755	hsa-miR-7157-5p	HITS-CLIP	23824327
MIRT613539	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT617754	hsa-miR-8060	HITS-CLIP	23824327
MIRT617753	hsa-miR-4738-3p	HITS-CLIP	23824327
MIRT617752	hsa-miR-7154-5p	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT613539	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT625277	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625276	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT625275	hsa-miR-603	HITS-CLIP	23824327
MIRT643331	hsa-miR-548p	HITS-CLIP	23824327
MIRT635077	hsa-miR-3938	HITS-CLIP	23824327
MIRT643330	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT635076	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT635075	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT635074	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT643329	hsa-miR-1468-3p	HITS-CLIP	23824327
MIRT625274	hsa-miR-3941	HITS-CLIP	23824327
MIRT635073	hsa-miR-623	HITS-CLIP	23824327
MIRT635072	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT635071	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT635070	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT635069	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT635068	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT635067	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT635066	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT635065	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT635064	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT635077	hsa-miR-3938	HITS-CLIP	23824327
MIRT613538	hsa-miR-665	HITS-CLIP	23824327
MIRT635076	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT635075	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT635074	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT625274	hsa-miR-3941	HITS-CLIP	23824327
MIRT635073	hsa-miR-623	HITS-CLIP	23824327
MIRT635072	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT635071	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT635070	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT635069	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT635068	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT635067	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT635066	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT635065	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT635064	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT613538	hsa-miR-665	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT625277	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625276	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT625275	hsa-miR-603	HITS-CLIP	23824327
MIRT613538	hsa-miR-665	HITS-CLIP	23824327
MIRT625274	hsa-miR-3941	HITS-CLIP	23824327
MIRT617751	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT617750	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT617749	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT617748	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT617747	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT617746	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT617745	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT617744	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT617742	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT617741	hsa-miR-3691-3p	HITS-CLIP	23824327
MIRT617740	hsa-miR-5695	HITS-CLIP	23824327
MIRT617758	hsa-miR-34a-3p	HITS-CLIP	23824327
MIRT617757	hsa-miR-3617-3p	HITS-CLIP	23824327
MIRT617756	hsa-miR-4310	HITS-CLIP	23824327
MIRT617755	hsa-miR-7157-5p	HITS-CLIP	23824327
MIRT613539	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT617754	hsa-miR-8060	HITS-CLIP	23824327
MIRT613538	hsa-miR-665	HITS-CLIP	23824327
MIRT617753	hsa-miR-4738-3p	HITS-CLIP	23824327
MIRT617752	hsa-miR-7154-5p	HITS-CLIP	23824327
MIRT617751	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT617750	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT617749	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT617748	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT617747	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT617746	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT617745	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT617744	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT617743	hsa-miR-1278	HITS-CLIP	23824327
MIRT617742	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT617741	hsa-miR-3691-3p	HITS-CLIP	23824327
MIRT617740	hsa-miR-5695	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT613539	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT613538	hsa-miR-665	HITS-CLIP	23824327
MIRT449258	hsa-miR-302a-3p	PAR-CLIP	22100165
MIRT449257	hsa-miR-302b-3p	PAR-CLIP	22100165
MIRT054070	hsa-miR-302c-3p	PAR-CLIP	22100165
MIRT449256	hsa-miR-302d-3p	PAR-CLIP	22100165
MIRT449255	hsa-miR-302e	PAR-CLIP	22100165
MIRT449254	hsa-miR-372-3p	PAR-CLIP	22100165
MIRT002551	hsa-miR-373-3p	PAR-CLIP	22100165
MIRT449253	hsa-miR-520a-3p	PAR-CLIP	22100165
MIRT004677	hsa-miR-520b	PAR-CLIP	22100165
MIRT054074	hsa-miR-520c-3p	PAR-CLIP	22100165
MIRT449252	hsa-miR-520d-3p	PAR-CLIP	22100165
MIRT449251	hsa-miR-520e	PAR-CLIP	22100165
MIRT054070	hsa-miR-302c-3p	PAR-CLIP	22100165
MIRT449250	hsa-miR-520f-3p	PAR-CLIP	22100165
MIRT449248	hsa-miR-4649-3p	PAR-CLIP	22100165
MIRT449249	hsa-miR-1827	PAR-CLIP	22100165
MIRT449247	hsa-miR-31-5p	PAR-CLIP	22100165
MIRT449246	hsa-miR-636	PAR-CLIP	22100165
MIRT449245	hsa-miR-1273e	PAR-CLIP	22100165
MIRT690585	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT690584	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT690583	hsa-miR-940	HITS-CLIP	23313552
MIRT690582	hsa-miR-3929	HITS-CLIP	23313552
MIRT690581	hsa-miR-4419b	HITS-CLIP	23313552
MIRT690580	hsa-miR-4478	HITS-CLIP	23313552
MIRT690579	hsa-miR-188-5p	HITS-CLIP	23313552
MIRT690578	hsa-miR-6866-3p	HITS-CLIP	23313552
MIRT613538	hsa-miR-665	HITS-CLIP	23313552
MIRT690577	hsa-miR-4780	HITS-CLIP	23313552
MIRT690576	hsa-miR-6780b-3p	HITS-CLIP	23313552
MIRT690575	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT449248	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT449249	hsa-miR-1827	HITS-CLIP	23313552
MIRT690574	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT690573	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT690572	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT690571	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT635073	hsa-miR-623	HITS-CLIP	23313552
MIRT690570	hsa-miR-425-3p	HITS-CLIP	23313552
MIRT690569	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT690568	hsa-miR-4293	HITS-CLIP	23313552
MIRT690567	hsa-miR-3622a-3p	HITS-CLIP	23313552
MIRT690566	hsa-miR-3622b-3p	HITS-CLIP	23313552
MIRT690565	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT690564	hsa-miR-4459	HITS-CLIP	23313552
MIRT690563	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT690562	hsa-miR-323b-3p	HITS-CLIP	23313552
MIRT690561	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT690560	hsa-miR-544b	HITS-CLIP	23313552
MIRT690559	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT690558	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT683688	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT683687	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT683686	hsa-miR-520h	HITS-CLIP	23313552
MIRT683685	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT683684	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT683683	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT683682	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT683681	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT683680	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT683679	hsa-miR-4425	HITS-CLIP	23313552
MIRT683678	hsa-miR-3147	HITS-CLIP	23313552
MIRT683677	hsa-miR-450b-3p	HITS-CLIP	23313552
MIRT683676	hsa-miR-769-3p	HITS-CLIP	23313552
MIRT683675	hsa-miR-6728-5p	HITS-CLIP	23313552
MIRT683674	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT683673	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT683672	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT678117	hsa-miR-8062	HITS-CLIP	23824327
MIRT678116	hsa-miR-6513-3p	HITS-CLIP	23824327
MIRT678115	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT678114	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT678113	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT678112	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT678111	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT678110	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT678109	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT678108	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT678107	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT678106	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT678105	hsa-miR-1297	HITS-CLIP	23824327
MIRT678104	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT678103	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT678102	hsa-miR-4465	HITS-CLIP	23824327
MIRT678101	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT678100	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT661763	hsa-miR-6847-5p	HITS-CLIP	23824327
MIRT661762	hsa-miR-4257	HITS-CLIP	23824327
MIRT661761	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT661760	hsa-miR-7977	HITS-CLIP	23824327
MIRT661759	hsa-miR-3942-3p	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT625277	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625276	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT625275	hsa-miR-603	HITS-CLIP	23824327
MIRT643331	hsa-miR-548p	HITS-CLIP	23824327
MIRT635077	hsa-miR-3938	HITS-CLIP	23824327
MIRT643330	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT613539	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT635076	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT635075	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT635074	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT661758	hsa-miR-3660	HITS-CLIP	23824327
MIRT661757	hsa-miR-4526	HITS-CLIP	23824327
MIRT643329	hsa-miR-1468-3p	HITS-CLIP	23824327
MIRT625274	hsa-miR-3941	HITS-CLIP	23824327
MIRT635073	hsa-miR-623	HITS-CLIP	23824327
MIRT635072	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT635071	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT635070	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT635069	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT635068	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT635067	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT635066	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT635065	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT635064	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT643342	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT643341	hsa-miR-2392	HITS-CLIP	23824327
MIRT643334	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT643340	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT643339	hsa-miR-4716-5p	HITS-CLIP	23824327
MIRT643338	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT643337	hsa-miR-383-5p	HITS-CLIP	23824327
MIRT643336	hsa-miR-4772-5p	HITS-CLIP	23824327
MIRT643335	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT643334	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT643333	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT643332	hsa-miR-5096	HITS-CLIP	23824327
MIRT617758	hsa-miR-34a-3p	HITS-CLIP	23824327
MIRT617757	hsa-miR-3617-3p	HITS-CLIP	23824327
MIRT617756	hsa-miR-4310	HITS-CLIP	23824327
MIRT617755	hsa-miR-7157-5p	HITS-CLIP	23824327
MIRT613539	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT617754	hsa-miR-8060	HITS-CLIP	23824327
MIRT617753	hsa-miR-4738-3p	HITS-CLIP	23824327
MIRT617752	hsa-miR-7154-5p	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT613539	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT625277	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625276	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT625275	hsa-miR-603	HITS-CLIP	23824327
MIRT643331	hsa-miR-548p	HITS-CLIP	23824327
MIRT635077	hsa-miR-3938	HITS-CLIP	23824327
MIRT643330	hsa-miR-6501-3p	HITS-CLIP	23824327
MIRT635076	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT635075	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT635074	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT643329	hsa-miR-1468-3p	HITS-CLIP	23824327
MIRT625274	hsa-miR-3941	HITS-CLIP	23824327
MIRT635073	hsa-miR-623	HITS-CLIP	23824327
MIRT635072	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT635071	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT635070	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT635069	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT635068	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT635067	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT635066	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT635065	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT635064	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT635077	hsa-miR-3938	HITS-CLIP	23824327
MIRT613538	hsa-miR-665	HITS-CLIP	23824327
MIRT635076	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT635075	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT635074	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT625274	hsa-miR-3941	HITS-CLIP	23824327
MIRT635073	hsa-miR-623	HITS-CLIP	23824327
MIRT635072	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT635071	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT635070	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT635069	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT635068	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT635067	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT635066	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT635065	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT635064	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT613538	hsa-miR-665	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT625277	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625276	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT625275	hsa-miR-603	HITS-CLIP	23824327
MIRT613538	hsa-miR-665	HITS-CLIP	23824327
MIRT625274	hsa-miR-3941	HITS-CLIP	23824327
MIRT617751	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT617750	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT617749	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT617748	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT617747	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT617746	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT617745	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT617744	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT617742	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT617741	hsa-miR-3691-3p	HITS-CLIP	23824327
MIRT617740	hsa-miR-5695	HITS-CLIP	23824327
MIRT617758	hsa-miR-34a-3p	HITS-CLIP	23824327
MIRT617757	hsa-miR-3617-3p	HITS-CLIP	23824327
MIRT617756	hsa-miR-4310	HITS-CLIP	23824327
MIRT617755	hsa-miR-7157-5p	HITS-CLIP	23824327
MIRT613539	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT617754	hsa-miR-8060	HITS-CLIP	23824327
MIRT613538	hsa-miR-665	HITS-CLIP	23824327
MIRT617753	hsa-miR-4738-3p	HITS-CLIP	23824327
MIRT617752	hsa-miR-7154-5p	HITS-CLIP	23824327
MIRT617751	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT617750	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT617749	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT617748	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT617747	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT617746	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT617745	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT617744	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT617743	hsa-miR-1278	HITS-CLIP	23824327
MIRT617742	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT617741	hsa-miR-3691-3p	HITS-CLIP	23824327
MIRT617740	hsa-miR-5695	HITS-CLIP	23824327
MIRT613540	hsa-miR-8485	HITS-CLIP	23824327
MIRT613539	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT613538	hsa-miR-665	HITS-CLIP	23824327
MIRT449258	hsa-miR-302a-3p	PAR-CLIP	22100165
MIRT449257	hsa-miR-302b-3p	PAR-CLIP	22100165
MIRT054070	hsa-miR-302c-3p	PAR-CLIP	22100165
MIRT449256	hsa-miR-302d-3p	PAR-CLIP	22100165
MIRT449255	hsa-miR-302e	PAR-CLIP	22100165
MIRT449254	hsa-miR-372-3p	PAR-CLIP	22100165
MIRT002551	hsa-miR-373-3p	PAR-CLIP	22100165
MIRT449253	hsa-miR-520a-3p	PAR-CLIP	22100165
MIRT004677	hsa-miR-520b	PAR-CLIP	22100165
MIRT054074	hsa-miR-520c-3p	PAR-CLIP	22100165
MIRT449252	hsa-miR-520d-3p	PAR-CLIP	22100165
MIRT449251	hsa-miR-520e	PAR-CLIP	22100165
MIRT054070	hsa-miR-302c-3p	PAR-CLIP	22100165
MIRT449250	hsa-miR-520f-3p	PAR-CLIP	22100165
MIRT449248	hsa-miR-4649-3p	PAR-CLIP	22100165
MIRT449249	hsa-miR-1827	PAR-CLIP	22100165
MIRT449247	hsa-miR-31-5p	PAR-CLIP	22100165
MIRT449246	hsa-miR-636	PAR-CLIP	22100165
MIRT449245	hsa-miR-1273e	PAR-CLIP	22100165
MIRT1148008	hsa-miR-106a	CLIP-seq
MIRT1148009	hsa-miR-106b	CLIP-seq
MIRT1148010	hsa-miR-1207-5p	CLIP-seq
MIRT1148011	hsa-miR-17	CLIP-seq
MIRT1148012	hsa-miR-20a	CLIP-seq
MIRT1148013	hsa-miR-20b	CLIP-seq
MIRT1148014	hsa-miR-302a	CLIP-seq
MIRT1148015	hsa-miR-302b	CLIP-seq
MIRT1148016	hsa-miR-302c	CLIP-seq
MIRT1148017	hsa-miR-302d	CLIP-seq
MIRT1148018	hsa-miR-3064-5p	CLIP-seq
MIRT1148019	hsa-miR-3153	CLIP-seq
MIRT1148020	hsa-miR-372	CLIP-seq
MIRT1148021	hsa-miR-373	CLIP-seq
MIRT1148022	hsa-miR-4514	CLIP-seq
MIRT1148023	hsa-miR-4645-5p	CLIP-seq
MIRT1148024	hsa-miR-4673	CLIP-seq
MIRT1148025	hsa-miR-4687-3p	CLIP-seq
MIRT1148026	hsa-miR-4692	CLIP-seq
MIRT1148027	hsa-miR-4763-3p	CLIP-seq
MIRT1148028	hsa-miR-519d	CLIP-seq
MIRT1148029	hsa-miR-520f	CLIP-seq
MIRT1148030	hsa-miR-93	CLIP-seq
MIRT2042137	hsa-miR-376a	CLIP-seq
MIRT2042138	hsa-miR-376b	CLIP-seq
MIRT2042139	hsa-miR-4496	CLIP-seq
MIRT2042140	hsa-miR-873	CLIP-seq
MIRT1148008	hsa-miR-106a	CLIP-seq
MIRT1148009	hsa-miR-106b	CLIP-seq
MIRT2271860	hsa-miR-1301	CLIP-seq
MIRT1148011	hsa-miR-17	CLIP-seq
MIRT1148012	hsa-miR-20a	CLIP-seq
MIRT1148013	hsa-miR-20b	CLIP-seq
MIRT1148014	hsa-miR-302a	CLIP-seq
MIRT1148015	hsa-miR-302b	CLIP-seq
MIRT1148016	hsa-miR-302c	CLIP-seq
MIRT1148017	hsa-miR-302d	CLIP-seq
MIRT2271861	hsa-miR-3140-3p	CLIP-seq
MIRT2271862	hsa-miR-3143	CLIP-seq
MIRT1148019	hsa-miR-3153	CLIP-seq
MIRT1148020	hsa-miR-372	CLIP-seq
MIRT1148021	hsa-miR-373	CLIP-seq
MIRT2271863	hsa-miR-450b-5p	CLIP-seq
MIRT1148022	hsa-miR-4514	CLIP-seq
MIRT1148023	hsa-miR-4645-5p	CLIP-seq
MIRT1148024	hsa-miR-4673	CLIP-seq
MIRT1148026	hsa-miR-4692	CLIP-seq
MIRT2271864	hsa-miR-5047	CLIP-seq
MIRT2271865	hsa-miR-507	CLIP-seq
MIRT2271866	hsa-miR-519a	CLIP-seq
MIRT2271867	hsa-miR-519b-3p	CLIP-seq
MIRT2271868	hsa-miR-519c-3p	CLIP-seq
MIRT1148028	hsa-miR-519d	CLIP-seq
MIRT1148029	hsa-miR-520f	CLIP-seq
MIRT2271869	hsa-miR-543	CLIP-seq
MIRT2271870	hsa-miR-557	CLIP-seq
MIRT1148030	hsa-miR-93	CLIP-seq
MIRT2271860	hsa-miR-1301	CLIP-seq
MIRT1148014	hsa-miR-302a	CLIP-seq
MIRT1148015	hsa-miR-302b	CLIP-seq
MIRT1148016	hsa-miR-302c	CLIP-seq
MIRT1148017	hsa-miR-302d	CLIP-seq
MIRT2271862	hsa-miR-3143	CLIP-seq
MIRT1148020	hsa-miR-372	CLIP-seq
MIRT1148021	hsa-miR-373	CLIP-seq
MIRT2271863	hsa-miR-450b-5p	CLIP-seq
MIRT2271864	hsa-miR-5047	CLIP-seq
MIRT2271865	hsa-miR-507	CLIP-seq
MIRT2271866	hsa-miR-519a	CLIP-seq
MIRT2271867	hsa-miR-519b-3p	CLIP-seq
MIRT2271868	hsa-miR-519c-3p	CLIP-seq
MIRT2271869	hsa-miR-543	CLIP-seq
MIRT2271870	hsa-miR-557	CLIP-seq
MIRT1148008	hsa-miR-106a	CLIP-seq
MIRT1148009	hsa-miR-106b	CLIP-seq
MIRT2271860	hsa-miR-1301	CLIP-seq
MIRT1148011	hsa-miR-17	CLIP-seq
MIRT1148012	hsa-miR-20a	CLIP-seq
MIRT1148013	hsa-miR-20b	CLIP-seq
MIRT1148014	hsa-miR-302a	CLIP-seq
MIRT1148015	hsa-miR-302b	CLIP-seq
MIRT1148016	hsa-miR-302c	CLIP-seq
MIRT1148017	hsa-miR-302d	CLIP-seq
MIRT2271862	hsa-miR-3143	CLIP-seq
MIRT1148019	hsa-miR-3153	CLIP-seq
MIRT1148020	hsa-miR-372	CLIP-seq
MIRT1148021	hsa-miR-373	CLIP-seq
MIRT2271863	hsa-miR-450b-5p	CLIP-seq
MIRT2271864	hsa-miR-5047	CLIP-seq
MIRT2271865	hsa-miR-507	CLIP-seq
MIRT1148028	hsa-miR-519d	CLIP-seq
MIRT1148029	hsa-miR-520f	CLIP-seq
MIRT2271869	hsa-miR-543	CLIP-seq
MIRT2271870	hsa-miR-557	CLIP-seq
MIRT1148030	hsa-miR-93	CLIP-seq
MIRT2271860	hsa-miR-1301	CLIP-seq
MIRT2271862	hsa-miR-3143	CLIP-seq
MIRT2271863	hsa-miR-450b-5p	CLIP-seq
MIRT2271864	hsa-miR-5047	CLIP-seq
MIRT2271865	hsa-miR-507	CLIP-seq
MIRT2271869	hsa-miR-543	CLIP-seq
MIRT2271870	hsa-miR-557	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
HDAC1	Unknown	17625602
HIF1A	Activation	21092233
HSF1	Activation	19139882
NFKB1	Unknown	15494508
RELA	Unknown	15494508
SP1	Activation	19139882
STAT3	Repression	21257710;23686482

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001913	Process	T cell mediated cytotoxicity	IDA	10426993
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002418	Process	Immune response to tumor cell	IDA	10359807
GO:0005515	Function	Protein binding	IPI	11323699, 21712812
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18676862
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA	10363723
GO:0005886	Component	Plasma membrane	IDA	18676862
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0006974	Process	DNA damage response	IDA	15995699
GO:0007165	Process	Signal transduction	IEA
GO:0009408	Process	Response to heat	IDA	8901601
GO:0009408	Process	Response to heat	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	8901601, 18676862
GO:0016020	Component	Membrane	IEA
GO:0030881	Function	Beta-2-microglobulin binding	IDA	8901601
GO:0031348	Process	Negative regulation of defense response	IEA
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0032815	Process	Negative regulation of natural killer cell activation	IDA	20068167
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	16582911, 17562706
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	10426993
GO:0042742	Process	Defense response to bacterium	IDA	11485740, 11830641
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IMP	20068167
GO:0046629	Process	Gamma-delta T cell activation	IDA	9497295
GO:0046629	Process	Gamma-delta T cell activation	IEA
GO:0046703	Function	Natural killer cell lectin-like receptor binding	IDA	11491531
GO:0046703	Function	Natural killer cell lectin-like receptor binding	IEA
GO:0046703	Function	Natural killer cell lectin-like receptor binding	IPI	10426993
GO:0048018	Function	Receptor ligand activity	IDA	11777960
GO:0050776	Process	Regulation of immune response	IEA
GO:0051607	Process	Defense response to virus	IDA	11224526, 16750166

MIM	HGNC	e!Ensembl
600169	7090	ENSG00000204520

Q29983

Protein name

MHC class I polypeptide-related sequence A (MIC-A)

Protein function

Widely expressed membrane-bound protein which acts as a ligand to stimulate an activating receptor KLRK1/NKG2D, expressed on the surface of essentially all human natural killer (NK), gammadelta T and CD8 alphabeta T-cells (PubMed:11491531, PubMe

PDB

1B3J , 1HYR , 7FI5 , 7FI6 , 7FI7 , 7FI8 , 7FI9 , 8TLZ , 8TM0 , 8TM2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00129	MHC_I	24 → 200	Class I Histocompatibility antigen, domains alpha 1 and 2	Domain
PF07654	C1-set	208 → 289	Immunoglobulin C1-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassal's

Sequence

MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCD
RQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCE
IHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHY
HAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWR
QDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKV
LVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHR
DATQLGFQPLMSDLGSTGSTEGA

Sequence length

383

Interactions

View interactions

	KEGG		Reactome
	Natural killer cell mediated cytotoxicity Kaposi sarcoma-associated herpesvirus infection		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (53)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL INTRAEPITHELIAL NEOPLASIA GRADE 2/3	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ANEURYSM	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE REPRODUCTIVE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROIDITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC EPIDERMAL NECROLYSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (241)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Addison Disease	Addison`s Disease	BEFREE	10523017, 12021133, 12366785, 19820007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21605422, 26940474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25363527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	17267578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	29721369		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMR Syndrome	Amr syndrome	Pubtator	21199204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	17102945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	10717805, 10990233, 8311558, 9174144, 9952031		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	GWASDB_DG	22138694		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	28279833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	37741520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	30177859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11407684, 12878725, 14730600, 19409079, 32123296, 32831971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	11390038, 12022360, 18799098, 19184033, 23611695, 23974432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	GWASCAT_DG	30552173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27439200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	22170063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28279833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12366785, 19662431, 25827949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	15055739, 16178876, 16417220, 19662431, 21506888, 36958849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	9598492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	25827949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	35437997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	10205273, 10369918, 10440244, 10513813, 11053265, 11182230, 11508592, 11796403, 12373294, 12492815, 12753668, 15934084, 16101830, 16784494, 19684014 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10205273, 10513813, 11796403, 12068141, 15529349, 15934084, 16784494, 21506888, 24136464, 24821759, 25889189, 26331842, 30252881, 31350414, 39317938, 9037047 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	GWASDB_DG	23041938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	15328155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11182222, 21221852, 22301547, 26662806, 26909862, 28383557, 29963058, 31691589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	1718386, 21069948, 22301547, 27026046, 34077462, 36641654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	8523185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	2848629, 7774641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11918717, 23024757, 26125933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	15205239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15546343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	18208618	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	22006220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18754878, 22302133, 22704489, 23024757, 23593449, 24204805, 24357186, 25031731, 25228093, 25393367, 26517016, 26893439, 27998720, 28427234, 28928439 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15994973, 29025772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22258792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33820913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19568411, 24289557, 24641397, 35936986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26349747	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11918717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	11918717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16778217, 22258792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	16101831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	11862400, 12074713, 12366785, 12542746, 15644122, 16698444, 18282752, 20492597, 24058482, 25797203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	15357948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	16151576, 18248301, 26045304		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	10566597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	16151576, 18248301, 26045304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	34489964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	25827949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26373575, 35223192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	25521205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	12854159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	19155520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	19594363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	11737059, 16178876, 19662431, 26940143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24687028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30988067, 34719204, 36958849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	18023027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14713847, 1606987, 18704411, 24641397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	CTD_human_DG	10899738		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	11782275, 21887729, 28684217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28684217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	11760399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	39447013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11118029, 16698430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11118029, 12021094, 12021138, 16698430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21506888, 7913951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22323559, 7913951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10594551, 10803866, 10819246, 10825591, 11194237, 11916171, 12021094, 12021133, 12021138, 12021140, 12021142, 12366785, 12691706, 15699508, 16164693 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12021138, 12021141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	11502807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	35437997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28722103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28722103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22258792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	12115588, 16705407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	29090365	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22370708, 30723271		★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	20667578, 23935919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Genital ulcers	Genital ulcers	BEFREE	12753668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	17003171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	25549595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23220408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	14695218, 15492287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	21199204, 22631059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35451026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	19654407, 25064744, 26483398, 27549307, 27987385, 28088489, 32153595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	27549307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	25972070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	26129751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	19008459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	19155520	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23024757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	31471884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	28427234, 28928439, 30723271, 30912093, 31471884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32683508	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29721369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28279833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	21199204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29693186	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31402756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19363685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29090365	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	19155520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28379387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	19280715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19447870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11737059, 11782275, 14530335, 16634869, 19230040, 20152875, 23822824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11737059, 19230040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	24058482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	22631059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	19155520	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	19155520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	24641397, 25987057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	18312485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	16164693, 22323559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	22323559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	16923796, 22168250, 23936864, 24152261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	16585609, 21477352, 22215138, 23445485, 30063799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21810082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	22304689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29449224, 37143070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	20460636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28404876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12569559, 16024634, 19826051, 21744989, 21873167, 23024757, 23593449, 23665287, 24061441, 25026299, 25228093, 25270965, 25393367, 26211651, 26299929 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21499248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	22370708, 28427234, 30723271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28417047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	18754878, 28427234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	25393367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23935919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23975858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23975858	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37679517	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21702010, 34012432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15522921, 16537577, 20352225, 29078849, 29912900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	15962390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15962390	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25031731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26349747	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	14695218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	25972070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21221852, 22301547, 26662806, 26909862, 28383557, 29963058, 31691589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	24641397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24061441, 25026299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15994973, 29025772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16778217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21605422, 24173243, 24885711, 26449615, 28470829, 31088566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19820934, 31004600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	11918717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15150599, 15962390, 17318812, 26364916, 26708143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	16621903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14639610, 16547745, 16585609, 17181741, 17565371, 19615970, 23918508, 24859012, 25330802, 27633040, 28379387, 28677817, 29090365, 29487978, 29635123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	16061555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	16151576, 18248301, 26045304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24687028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10079252, 10478640, 17934731, 24994597, 26564811, 7543821, 9637706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15853896, 18385764, 1905328, 26564811, 29720199, 30451786, 7543821, 8432869, 8795138, 9637706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	22222578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30440052, 31522222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	26902929, 28536458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	25203601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	33730629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	18202175, 23686482, 26269456, 27903272, 29765374, 34482362, 35967396, 37460534, 38191242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26071561, 26269456, 31125275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15699507, 18588574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	22184268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	17341666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15973179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11292469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16547745, 21536588, 23209447, 27870115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18087217, 21536588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10426994, 11182222, 12115588, 12516095, 12714493, 12894536, 1358827, 14519625, 15546343, 16621903, 16705407, 16750857, 16924494, 17181741, 17911639 View all (37 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11260505, 15548365, 9476965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15548365, 21061445, 36521927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16924494, 23975858, 25363527, 26940474, 31827723		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	14675133		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral Submucous Fibrosis	CTD_human_DG	16311067		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	21042760, 22923031, 22992985, 24203492, 30409432		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16778217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21935360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21605422, 24173243, 24885711, 26449615, 28470829, 31088566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31166958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	11737059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	11313318, 11584356, 15947556, 17383044, 18023027, 25521205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19820934, 31004600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	31004600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11169245, 12653732, 15140030, 19184033, 23611695, 23974432		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	21506888, 25087609	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	10951140, 11390038, 12651072, 25087609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	12894536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	24641397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14713847, 1606987, 18704411, 24641397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	14983503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23157549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11491503, 14630402, 17003176, 19409079, 21702010, 25256191, 28752674, 29665245		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	19503088, 21156761, 21653640		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	24861996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	30471872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	18754036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	28379387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	11918717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	12753668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29020964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	1325431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	10990233, 16720212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	23727634, 30177859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11918717, 12190814, 16061555, 17181741		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21362330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19414815, 22524849, 33730629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15814633, 16234579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	24861996		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15150599, 15962390, 26364916, 26708143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15150599, 26708143, 33868281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15962390	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	20460636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	10980346, 28261975, 9951809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	26113176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymus Hyperplasia	Thymus Hyperplasia	BEFREE	26113176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16621903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16621903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	22006220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	24861996		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37685962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11169253, 11782275, 12878361, 16178876, 19662431, 20152875, 21155878, 21887729, 23822824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	16061555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10727458, 18208618, 21477352, 24403192, 33794208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	15205239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	15381927	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	16379028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	19657978, 25468490		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular System Injuries	Vascular system injury	Pubtator	22170063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	17003171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	34489964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	21857986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	31877315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MICA (MHC class I polypeptide-related sequence A)