Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10043
Gene name	Target of myb1 membrane trafficking protein
Gene symbol	TOM1
Synonyms (NCBI Gene)	IMD85
Chromosome	22
Chromosome location	22q12.3
Summary	This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. S

107

Show/Hide all (107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000967	hsa-miR-126-3p	Luciferase reporter assay	18834857
MIRT000967	hsa-miR-126-3p	Luciferase reporter assayqRT-PCRWestern blot	20083669
MIRT000967	hsa-miR-126-3p	Reporter assay;Western blot	20083669
MIRT028407	hsa-miR-30a-5p	Proteomics	18668040
MIRT046596	hsa-miR-222-3p	CLASH	23622248
MIRT000967	hsa-miR-126-3p	MicroarrayqRT-PCR	22815788
MIRT437630	hsa-miR-150-5p	MicroarrayqRT-PCR	22815788
MIRT437740	hsa-miR-34a-5p	MicroarrayqRT-PCR	22815788
MIRT720989	hsa-miR-6858-3p	HITS-CLIP	19536157
MIRT720988	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT720987	hsa-miR-6748-3p	HITS-CLIP	19536157
MIRT720986	hsa-miR-3194-5p	HITS-CLIP	19536157
MIRT720985	hsa-miR-214-5p	HITS-CLIP	19536157
MIRT716272	hsa-miR-1296-3p	HITS-CLIP	19536157
MIRT716271	hsa-miR-6729-3p	HITS-CLIP	19536157
MIRT716270	hsa-miR-338-3p	HITS-CLIP	19536157
MIRT716269	hsa-miR-6801-3p	HITS-CLIP	19536157
MIRT716268	hsa-miR-6810-3p	HITS-CLIP	19536157
MIRT716267	hsa-miR-331-3p	HITS-CLIP	19536157
MIRT716266	hsa-miR-345-3p	HITS-CLIP	19536157
MIRT716265	hsa-miR-4786-3p	HITS-CLIP	19536157
MIRT716264	hsa-miR-324-5p	HITS-CLIP	19536157
MIRT716263	hsa-miR-874-5p	HITS-CLIP	19536157
MIRT716262	hsa-miR-296-5p	HITS-CLIP	19536157
MIRT716261	hsa-miR-6762-5p	HITS-CLIP	19536157
MIRT716260	hsa-miR-6845-5p	HITS-CLIP	19536157
MIRT716259	hsa-miR-128-1-5p	HITS-CLIP	19536157
MIRT716258	hsa-miR-128-2-5p	HITS-CLIP	19536157
MIRT716257	hsa-miR-3151-5p	HITS-CLIP	19536157
MIRT716256	hsa-miR-7843-3p	HITS-CLIP	19536157
MIRT716255	hsa-miR-1227-5p	HITS-CLIP	19536157
MIRT720989	hsa-miR-6858-3p	HITS-CLIP	19536157
MIRT720988	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT720987	hsa-miR-6748-3p	HITS-CLIP	19536157
MIRT720986	hsa-miR-3194-5p	HITS-CLIP	19536157
MIRT720985	hsa-miR-214-5p	HITS-CLIP	19536157
MIRT716272	hsa-miR-1296-3p	HITS-CLIP	19536157
MIRT716271	hsa-miR-6729-3p	HITS-CLIP	19536157
MIRT716270	hsa-miR-338-3p	HITS-CLIP	19536157
MIRT716269	hsa-miR-6801-3p	HITS-CLIP	19536157
MIRT716268	hsa-miR-6810-3p	HITS-CLIP	19536157
MIRT716267	hsa-miR-331-3p	HITS-CLIP	19536157
MIRT716266	hsa-miR-345-3p	HITS-CLIP	19536157
MIRT716265	hsa-miR-4786-3p	HITS-CLIP	19536157
MIRT716264	hsa-miR-324-5p	HITS-CLIP	19536157
MIRT716263	hsa-miR-874-5p	HITS-CLIP	19536157
MIRT716262	hsa-miR-296-5p	HITS-CLIP	19536157
MIRT716261	hsa-miR-6762-5p	HITS-CLIP	19536157
MIRT716260	hsa-miR-6845-5p	HITS-CLIP	19536157
MIRT716259	hsa-miR-128-1-5p	HITS-CLIP	19536157
MIRT716258	hsa-miR-128-2-5p	HITS-CLIP	19536157
MIRT716257	hsa-miR-3151-5p	HITS-CLIP	19536157
MIRT716256	hsa-miR-7843-3p	HITS-CLIP	19536157
MIRT716255	hsa-miR-1227-5p	HITS-CLIP	19536157
MIRT1446243	hsa-miR-1252	CLIP-seq
MIRT1446244	hsa-miR-2392	CLIP-seq
MIRT1446245	hsa-miR-3125	CLIP-seq
MIRT1446246	hsa-miR-3616-3p	CLIP-seq
MIRT1446247	hsa-miR-3916	CLIP-seq
MIRT1446248	hsa-miR-4428	CLIP-seq
MIRT1446249	hsa-miR-4476	CLIP-seq
MIRT1446250	hsa-miR-4533	CLIP-seq
MIRT1446251	hsa-miR-4534	CLIP-seq
MIRT1446252	hsa-miR-4802-5p	CLIP-seq
MIRT2133407	hsa-miR-1184	CLIP-seq
MIRT2133408	hsa-miR-1827	CLIP-seq
MIRT2133409	hsa-miR-2278	CLIP-seq
MIRT2133410	hsa-miR-3153	CLIP-seq
MIRT2133411	hsa-miR-3156-3p	CLIP-seq
MIRT2133412	hsa-miR-3173-3p	CLIP-seq
MIRT2133413	hsa-miR-361-3p	CLIP-seq
MIRT2133414	hsa-miR-4301	CLIP-seq
MIRT2133415	hsa-miR-4418	CLIP-seq
MIRT2133416	hsa-miR-509-3-5p	CLIP-seq
MIRT2133417	hsa-miR-509-5p	CLIP-seq
MIRT2354599	hsa-miR-1207-3p	CLIP-seq
MIRT2354600	hsa-miR-4691-3p	CLIP-seq
MIRT2354601	hsa-miR-4731-5p	CLIP-seq
MIRT2133408	hsa-miR-1827	CLIP-seq
MIRT2133409	hsa-miR-2278	CLIP-seq
MIRT2133412	hsa-miR-3173-3p	CLIP-seq
MIRT2396200	hsa-miR-3612	CLIP-seq
MIRT2396201	hsa-miR-4695-5p	CLIP-seq
MIRT2396202	hsa-miR-650	CLIP-seq
MIRT2693856	hsa-miR-1203	CLIP-seq
MIRT2693857	hsa-miR-1538	CLIP-seq
MIRT2693858	hsa-miR-3179	CLIP-seq
MIRT2693859	hsa-miR-3189-3p	CLIP-seq
MIRT2693860	hsa-miR-34a	CLIP-seq
MIRT2693861	hsa-miR-34c-3p	CLIP-seq
MIRT2693862	hsa-miR-34c-5p	CLIP-seq
MIRT2693863	hsa-miR-3622b-5p	CLIP-seq
MIRT2693864	hsa-miR-4253	CLIP-seq
MIRT2693865	hsa-miR-4260	CLIP-seq
MIRT2693866	hsa-miR-4265	CLIP-seq
MIRT2693867	hsa-miR-4296	CLIP-seq
MIRT2693868	hsa-miR-4302	CLIP-seq
MIRT2693869	hsa-miR-4322	CLIP-seq
MIRT2693870	hsa-miR-4417	CLIP-seq
MIRT2693871	hsa-miR-4437	CLIP-seq
MIRT2693872	hsa-miR-4448	CLIP-seq
MIRT2693873	hsa-miR-449a	CLIP-seq
MIRT2693874	hsa-miR-449b	CLIP-seq
MIRT2693875	hsa-miR-4674	CLIP-seq
MIRT2693876	hsa-miR-4745-3p	CLIP-seq
MIRT2693877	hsa-miR-486-3p	CLIP-seq
MIRT2693878	hsa-miR-760	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14563850, 14613930, 15047686, 15657082, 16412388, 19798056, 25416956, 26320582, 31263572, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IDA	14563850, 15047686, 16412388
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IDA	15047686, 16412388
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	14613930, 15047686, 25588840, 26320582
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA	14613930
GO:0005886	Component	Plasma membrane	TAS
GO:0006897	Process	Endocytosis	NAS	10329004
GO:0007165	Process	Signal transduction	IBA
GO:0010008	Component	Endosome membrane	IDA	23023224
GO:0010008	Component	Endosome membrane	IEA
GO:0010314	Function	Phosphatidylinositol-5-phosphate binding	IDA	25588840
GO:0015031	Process	Protein transport	IEA
GO:0015031	Process	Protein transport	NAS	14613930
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	14613930
GO:0016020	Component	Membrane	IEA
GO:0016197	Process	Endosomal transport	IDA	14563850, 26320582
GO:0016197	Process	Endosomal transport	NAS	14613930
GO:0016197	Process	Endosomal transport	TAS	10329004
GO:0030276	Function	Clathrin binding	IBA
GO:0030276	Function	Clathrin binding	IDA	16412388
GO:0030276	Function	Clathrin binding	IEA
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IDA	14563850, 15047686
GO:0031901	Component	Early endosome membrane	IEA
GO:0032050	Function	Clathrin heavy chain binding	IDA	14563850, 15657082
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0035579	Component	Specific granule membrane	TAS
GO:0043130	Function	Ubiquitin binding	IDA	16199040, 31263572
GO:0043130	Function	Ubiquitin binding	IEA
GO:0061753	Process	Substrate localization to autophagosome	IMP	23023224
GO:0061909	Process	Autophagosome-lysosome fusion	IMP	23023224
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070853	Function	Myosin VI binding	IDA	23023224, 31371777
GO:1901098	Process	Positive regulation of autophagosome maturation	IMP	23023224
GO:1904978	Process	Regulation of endosome organization	IDA	25588840

MIM	HGNC	e!Ensembl
604700	11982	ENSG00000100284

O60784

Protein name

Target of Myb1 membrane trafficking protein (Target of Myb protein 1)

Protein function

Adapter protein that plays a role in the intracellular membrane trafficking of ubiquitinated proteins, thereby participating in autophagy, ubiquitination-dependent signaling and receptor recycling pathways (PubMed:14563850, PubMed:15047686, PubM

PDB

1ELK , 1WRD , 2N2N , 2N9D , 6J56

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00790	VHS	7 → 148	VHS domain	Domain
PF03127	GAT	228 → 303	GAT domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highly expressed in skeletal muscle, heart, placenta and liver. {ECO:0000269|PubMed:10329004}.

Sequence

MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVG
NKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNL
IQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDS
VGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTE
LVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHER
FERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASG
RLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDI
EQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKK
TQEKDDDMLFAL

Sequence length

492

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Immunodeficiency 85 and autoimmunity	Pathogenic	rs778537779	RCV001597556	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 2	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12915891, 3103721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30185465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	17671966		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	17671966		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20083669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	20083669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31570577		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	17671966		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	17671966		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	PSYGENET_DG	17671966		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	17671966		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	17671966		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	17671966		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	17671966		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	17671966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	GWASCAT_DG	26007630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	LHGDN	17671966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	GWASCAT_DG	26007630, 27363682		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paraproteinemias	Paraproteinemia	GWASCAT_DG	26007630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	3103721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	28067908		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TOM1 (target of myb1 membrane trafficking protein)