CHAF1A (chromatin assembly factor 1 subunit A)

Gene

• Entrez ID: 10036
• Gene name: Chromatin assembly factor 1 subunit A
• Gene symbol: CHAF1A
• Synonyms (NCBI Gene): CAF-1, CAF1, CAF1B, CAF1P150, P150
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).[supplied by OMIM, Mar 20

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001559	hsa-miR-155-5p	pSILAC	18668040
MIRT016160	hsa-miR-590-3p	Sequencing	20371350
MIRT001559	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT032279	hsa-let-7b-5p	Proteomics	18668040
MIRT049115	hsa-miR-92a-3p	CLASH	23622248
MIRT151700	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT151690	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT151700	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT151689	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT151710	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT151693	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT151722	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT151690	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT151691	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT151692	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT888517	hsa-miR-106a	CLIP-seq
MIRT888518	hsa-miR-106b	CLIP-seq
MIRT888519	hsa-miR-1204	CLIP-seq
MIRT888520	hsa-miR-1275	CLIP-seq
MIRT888521	hsa-miR-1286	CLIP-seq
MIRT888522	hsa-miR-1293	CLIP-seq
MIRT888523	hsa-miR-155	CLIP-seq
MIRT888524	hsa-miR-17	CLIP-seq
MIRT888525	hsa-miR-20a	CLIP-seq
MIRT888526	hsa-miR-20b	CLIP-seq
MIRT888527	hsa-miR-2110	CLIP-seq
MIRT888528	hsa-miR-216a	CLIP-seq
MIRT888529	hsa-miR-302a	CLIP-seq
MIRT888530	hsa-miR-302b	CLIP-seq
MIRT888531	hsa-miR-302c	CLIP-seq
MIRT888532	hsa-miR-302d	CLIP-seq
MIRT888533	hsa-miR-302e	CLIP-seq
MIRT888534	hsa-miR-3129-3p	CLIP-seq
MIRT888535	hsa-miR-3130-3p	CLIP-seq
MIRT888536	hsa-miR-3150a-3p	CLIP-seq
MIRT888537	hsa-miR-3175	CLIP-seq
MIRT888538	hsa-miR-323-5p	CLIP-seq
MIRT888539	hsa-miR-337-3p	CLIP-seq
MIRT888540	hsa-miR-338-3p	CLIP-seq
MIRT888541	hsa-miR-3656	CLIP-seq
MIRT888542	hsa-miR-372	CLIP-seq
MIRT888543	hsa-miR-373	CLIP-seq
MIRT888544	hsa-miR-3937	CLIP-seq
MIRT888545	hsa-miR-3941	CLIP-seq
MIRT888546	hsa-miR-4260	CLIP-seq
MIRT888547	hsa-miR-4435	CLIP-seq
MIRT888548	hsa-miR-4436a	CLIP-seq
MIRT888549	hsa-miR-4477a	CLIP-seq
MIRT888550	hsa-miR-4483	CLIP-seq
MIRT888551	hsa-miR-4525	CLIP-seq
MIRT888552	hsa-miR-4530	CLIP-seq
MIRT888553	hsa-miR-466	CLIP-seq
MIRT888554	hsa-miR-4665-5p	CLIP-seq
MIRT888555	hsa-miR-4672	CLIP-seq
MIRT888556	hsa-miR-4680-5p	CLIP-seq
MIRT888557	hsa-miR-4685-5p	CLIP-seq
MIRT888558	hsa-miR-4717-5p	CLIP-seq
MIRT888559	hsa-miR-4723-5p	CLIP-seq
MIRT888560	hsa-miR-4755-3p	CLIP-seq
MIRT888561	hsa-miR-4793-3p	CLIP-seq
MIRT888562	hsa-miR-519d	CLIP-seq
MIRT888563	hsa-miR-520a-3p	CLIP-seq
MIRT888564	hsa-miR-520b	CLIP-seq
MIRT888565	hsa-miR-520c-3p	CLIP-seq
MIRT888566	hsa-miR-520d-3p	CLIP-seq
MIRT888567	hsa-miR-520d-5p	CLIP-seq
MIRT888568	hsa-miR-520e	CLIP-seq
MIRT888569	hsa-miR-520g	CLIP-seq
MIRT888570	hsa-miR-520h	CLIP-seq
MIRT888571	hsa-miR-524-5p	CLIP-seq
MIRT888572	hsa-miR-625	CLIP-seq
MIRT888573	hsa-miR-635	CLIP-seq
MIRT888574	hsa-miR-93	CLIP-seq
MIRT888575	hsa-miR-939	CLIP-seq
MIRT888534	hsa-miR-3129-3p	CLIP-seq
MIRT888536	hsa-miR-3150a-3p	CLIP-seq
MIRT888537	hsa-miR-3175	CLIP-seq
MIRT888539	hsa-miR-337-3p	CLIP-seq
MIRT888540	hsa-miR-338-3p	CLIP-seq
MIRT888552	hsa-miR-4530	CLIP-seq
MIRT2199806	hsa-miR-4729	CLIP-seq
MIRT2199807	hsa-miR-4760-3p	CLIP-seq
MIRT2199808	hsa-miR-4785	CLIP-seq
MIRT2199809	hsa-miR-579	CLIP-seq
MIRT2199810	hsa-miR-627	CLIP-seq
MIRT2199811	hsa-miR-664	CLIP-seq
MIRT888575	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	9614144, 14718166
GO:0003682	Function	Chromatin binding	TAS	7600578
GO:0005515	Function	Protein binding	IPI	15805117, 16826239, 17474147, 19498464, 20562864, 20936779, 21570500, 23075851, 24981860, 25416956, 26496610, 27705803, 31980649, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006334	Process	Nucleosome assembly	IBA
GO:0006334	Process	Nucleosome assembly	IDA	14718166
GO:0006335	Process	DNA replication-dependent chromatin assembly	IDA	8858152, 9614144
GO:0006974	Process	DNA damage response	IEA
GO:0032991	Component	Protein-containing complex	IDA	14718166
GO:0033186	Component	CAF-1 complex	IBA
GO:0033186	Component	CAF-1 complex	IDA	8858152
GO:0033186	Component	CAF-1 complex	IPI	9614144
GO:0042802	Function	Identical protein binding	IPI	16826239
GO:0051082	Function	Unfolded protein binding	TAS	7600578
GO:0070087	Function	Chromo shadow domain binding	IPI	15882967

Other IDs

• MIM: 601246
• HGNC: 1910
• e!Ensembl: ENSG00000167670

Protein

• UniProt ID: Q13111
• Protein name: Chromatin assembly factor 1 subunit A (CAF-1 subunit A) (Chromatin assembly factor I p150 subunit) (CAF-I 150 kDa subunit) (CAF-I p150) (hp150)
• Protein function: Acts as a component of the histone chaperone complex chromatin assembly factor 1 (CAF-1), which assembles histone octamers onto DNA during replication and repair. CAF-1 performs the first step of the nucleosome assembly process, bringing newly s
• PDB: 7Y5K, 7Y5L, 7Y5O, 7Y5U, 7Y5V, 7Y60, 7Y61, 8IQF, 8IQG, 8J6S, 8J6T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15557	CAF1-p150_N	1 → 226	CAF1 complex subunit p150, region binding to PCNA	Domain
  PF11600	CAF-1_p150	320 → 479		Disordered
  PF12253	CAF1A	558 → 632	Chromatin assembly factor 1 subunit A	Family
  PF15539	CAF1-p150_C2	665 → 954	CAF1 complex subunit p150, region binding to CAF1-p60 at C-term	Domain

• Sequence:

  MLEELECGAPGARGAATAMDCKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTS
  VQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT
  EDSNEQPDSLVDHNKLNSEASPSREAINGQREDTGDQQGLLKAIQNDKLAFPGETLSDIP
  CKTEEEGVGCGGAGRRGDSQECSPRSCPELTSGPRMCPRKEQDSWSEAGGILFKGKVPMV
  VLQDILAVRPPQIKSLPATPQGKNMTPESEVLESFPEEDSVLSHSSLSSPSSTSSPEGPP
  APPKQHSSTSPFPTSTPLRRITKKFVKGSTEKNKLRLQRDQERLGKQLKLRAEREEKEKL
  KEEAKRAKEEAKKKKEEEKELKEKERREKREKDEKEKAEKQRLKEERRKERQEALEAKLE
  EKRKKEEEKRLREEEKRIKAEKAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLA
  PRRRTAFHPDLCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHVSTRNADIFNSDVVIV
  ERGKGDGVPERRKFGRMKLLQFCENHRPAYWGTWNKKTALIRARDPWAQDTKLLDYEVDS
  DEEWEEEEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVR
  QKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEE
  QTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTY
  LHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWS
  YVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGF
  QADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS

• Sequence length: 956

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GOLDENHAR SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	16240349, 17824900		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	26125848	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	10807475, 11444929		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30744595		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	23275297		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	27613841	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18458534, 21083601, 22954256, 30756331		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21083601		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33785812	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26152796, 30744595		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	28374866		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35508649	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23273547, 28286267, 29041931		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15382063		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24052018, 24845563		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	23109837		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29121716		★☆☆☆☆ Found in Text Mining only
Dyschromatosis symmetrica hereditaria 1	Dyschromatosis symmetrica hereditaria	Pubtator	33723056	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	29908751		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28286267		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30367467, 30463848		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30367467, 30463848		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32375686	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	16240349, 17824900		★☆☆☆☆ Found in Text Mining only
Gingival Recession	Gingival Recession	BEFREE	29873085, 30099762, 30293186		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25712375		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25712375		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18048407		★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	BEFREE	28374866		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28374866	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28374866		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25697104		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30536318	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24836587, 28553742		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	18458534, 21083601, 22954256, 30756331		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30367467, 30463848		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	28374866		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26398776		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25697104		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23273547, 29041931		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15382063, 30449701, 31377317, 31633246		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26152796, 30744595		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19470942, 21083601, 23109837, 24039846, 24335960, 24845563, 25697104, 26893143, 27425378, 27488962, 28286267, 29344235, 30254333, 31505876		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24052018, 24845563		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30871158		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29908751		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth Diseases	CTD_human_DG	17682004		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth neoplasm	Pubtator	22882088	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	31413087	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17824900		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	29533181	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	29533181		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	33098490	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15382063, 19470942, 21083601, 21112238, 21804603, 23109837, 24845563, 27128408, 27425378, 28178651, 29506142, 30463848, 30683902, 31377317, 31749406		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24335960, 27425378		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24348903	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29201167, 30536318		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28132653		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	23273547		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29041931		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23029531	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	23143281		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	10807475		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	27177087		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15067324		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23661607	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21083601		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	33277876	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17543081, 31627329		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29029429, 30463848		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22882088, 39748725	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	17543081, 31604589		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15382063, 30449701, 31377317, 31633246		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33785812, 38235318, 38254099	Associate	★☆☆☆☆ Found in Text Mining only
Symmetrical dyschromatosis of extremities	Symmetrical Dyschromatosis Of Extremities	BEFREE	23621630		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33616161, 33740340	Associate	★☆☆☆☆ Found in Text Mining only
Warburg Sjo Fledelius syndrome	Warburg Micro Syndrome	BEFREE	18413245		★☆☆☆☆ Found in Text Mining only