Gene Gene information from NCBI Gene database.
Entrez ID 100288687
Gene name Double homeobox 4
Gene symbol DUX4
Synonyms (NCBI Gene)
DUX4L
Chromosome 4
Chromosome location 4q35.2
Summary This gene is located within a D4Z4 repeat array in the subtelomeric region of chromosome 4q. The D4Z4 repeat is polymorphic in length; a similar D4Z4 repeat array has been identified on chromosome 10. Each D4Z4 repeat unit has an open reading frame (named
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
PITX1 Unknown 23206257
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000976 Function Transcription cis-regulatory region binding IDA 17984056
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 17984056
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 17984056, 30315230
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606009 50800 ENSG00000260596
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBX2
Protein name Double homeobox protein 4 (Double homeobox protein 10)
Protein function [Isoform 1]: Transcription factor that is selectively and transiently expressed in cleavage-stage embryos (PubMed:28459457). Binds to double-stranded DNA elements with the consensus sequence 5'-TAATCTAATCA-3' (PubMed:28459454, PubMed:28459457, P
PDB 5Z2S , 5Z2T , 5Z6Z , 5ZFW , 5ZFY , 5ZFZ , 6A8R , 6DFY , 6E8C , 6U81 , 6U82
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 20 76 Homeodomain Domain
PF00046 Homeodomain 95 149 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1: Does not seem to be expressed in normal muscle, but is detected in muscle of individuals with FSHD, and also in testis (at protein level) (PubMed:17984056, PubMed:21060811). Isoform 1: Does not seem to be expressed in normal
Sequence
MALPTPSDSTLPAEARGRGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPE
PRVQIWFQNERSRQLR
QHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPG
IAAREELARETGLPESRIQIWFQNRRARH
PGQGGRAPAQAGGLCSAAPGGGHPAPSWVAF
AHTGAWGTGLPAPHVPCAPGALPQGAFVSQAARAAPALQPSQAAPAEGISQPAPARGDFA
YAAPAPPDGALSHPQAPRWPPHPGKSREDRDPQRDGLPGPCAVAQPGPAQAGPQGQGVLA
PPTSQGSPWWGWGRGPQVAGAAWEPQAGAAPPPQPAPPDASASARQGQMQGIPAPSQALQ
EPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRAL
LEEL
Sequence length 424
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
FACIOSCAPULOHUMERAL DYSTROPHY Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 27019113, 27265895, 27776115, 29330417, 30322619, 30862934
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 27019113, 27776115
★☆☆☆☆
Found in Text Mining only
Adult Oligodendroglioma Oligodendroglioma BEFREE 28278156
★☆☆☆☆
Found in Text Mining only
Alveolar rhabdomyosarcoma Alveolar Rhabdomyosarcoma BEFREE 27879517
★☆☆☆☆
Found in Text Mining only
Arhinia choanal atresia and microphthalmia Arhinia-choanal atresia-microphthalmia syndrome Pubtator 30698748, 35121673, 36800423 Associate
★☆☆☆☆
Found in Text Mining only
Arhinia, choanal atresia, and microphthalmia Arrhinia with choanal atresia and microphthalmia syndrome BEFREE 30698748
★☆☆☆☆
Found in Text Mining only
Ataxia Telangiectasia Ataxia telangiectasia Pubtator 30107443 Associate
★☆☆☆☆
Found in Text Mining only
Atrophy Atrophy Pubtator 23272181 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 22072439 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma Pubtator 32014859 Associate
★☆☆☆☆
Found in Text Mining only