TROAP (trophinin associated protein)

Gene

• Entrez ID: 10024
• Gene name: Trophinin associated protein
• Gene symbol: TROAP
• Synonyms (NCBI Gene): TASTIN
• Chromosome: 12
• Chromosome location: 12q13.12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024690	hsa-miR-215-5p	Microarray	19074876
MIRT026899	hsa-miR-192-5p	Microarray	19074876
MIRT042226	hsa-miR-484	CLASH	23622248
MIRT039703	hsa-miR-615-3p	CLASH	23622248
MIRT734530	hsa-miR-519d-3p	Luciferase reporter assay, Immunoprecipitaion (IP), qRT-PCR	32796815
MIRT736978	hsa-miR-532-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34287099
MIRT1457132	hsa-miR-1245	CLIP-seq
MIRT1457133	hsa-miR-1825	CLIP-seq
MIRT1457134	hsa-miR-1976	CLIP-seq
MIRT1457135	hsa-miR-199a-5p	CLIP-seq
MIRT1457136	hsa-miR-199b-5p	CLIP-seq
MIRT1457137	hsa-miR-3176	CLIP-seq
MIRT1457138	hsa-miR-370	CLIP-seq
MIRT1457139	hsa-miR-3922-3p	CLIP-seq
MIRT1457140	hsa-miR-3925-3p	CLIP-seq
MIRT1457141	hsa-miR-4757-5p	CLIP-seq
MIRT1457142	hsa-miR-515-5p	CLIP-seq
MIRT2462407	hsa-miR-1273f	CLIP-seq
MIRT2462408	hsa-miR-1276	CLIP-seq
MIRT2462409	hsa-miR-4287	CLIP-seq
MIRT2462410	hsa-miR-4311	CLIP-seq
MIRT2462411	hsa-miR-4469	CLIP-seq
MIRT2462412	hsa-miR-450b-3p	CLIP-seq
MIRT2462413	hsa-miR-4685-3p	CLIP-seq
MIRT2462414	hsa-miR-4713-3p	CLIP-seq
MIRT2462415	hsa-miR-583	CLIP-seq
MIRT2462416	hsa-miR-638	CLIP-seq
MIRT2462417	hsa-miR-769-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	9560222, 17360433, 19060904, 21516116, 23602568, 25416956, 26949739, 28514442, 30561431, 32296183, 32707033, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	7758945
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	7758945

Other IDs

• MIM: 603872
• HGNC: 12327
• e!Ensembl: ENSG00000135451

Protein

• UniProt ID: Q12815
• Protein name: Tastin (Trophinin-assisting protein) (Trophinin-associated protein)
• Protein function: Could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation.
• Tissue specificity: TISSUE SPECIFICITY: Strong expression at implantation sites. Was exclusively localized to the apical side of the syncytiotrophoblast. Also found in macrophages.
• Sequence:

  MTTRQATKDPLLRGVSPTPSKIPVRSQKRTPFPTVTSCAVDQENQDPRRWVQKPPLNIQR
  PLVDSAGPRPKARHQAETSQRLVGISQPRNPLEELRPSPRGQNVGPGPPAQTEAPGTIEF
  VADPAALATILSGEGVKSCHLGRQPSLAKRVLVRGSQGGTTQRVQGVRASAYLAPRTPTH
  RLDPARASCFSRLEGPGPRGRTLCPQRLQALISPSGPSFHPSTRPSFQELRRETAGSSRT
  SVSQASGLLLETPVQPAFSLPKGEREVVTHSDEGGVASLGLAQRVPLRENREMSHTRDSH
  DSHLMPSPAPVAQPLPGHVVPCPSPFGRAQRVPSPGPPTLTSYSVLRRLTVQPKTRFTPM
  PSTPRVQQAQWLRGVSPQSCSEDPALPWEQVAVRLFDQESCIRSLEGSGKPPVATPSGPH
  SNRTPSLQEVKIQRIGILQQLLRQEVEGLVGGQCVPLNGGSSLDMVELQPLLTEISRTLN
  ATEHNSGTSHLPGLLKHSGLPKPCLPEECGEPQPCPPAEPGPPEAFCRSEPEIPEPSLQE
  QLEVPEPYPPAEPRPLESCCRSEPEIPESSRQEQLEVPEPCPPAEPRPLESYCRIEPEIP
  ESSRQEQLEVPEPCPPAEPGPLQPSTQGQSGPPGPCPRVELGASEPCTLEHRSLESSLPP
  CCSQWAPATTSLIFSSQHPLCASPPICSLQSLRPPAGQAGLSNLAPRTLALRERLKSCLT
  AIHCFHEARLDDECAFYTSRAPPSGPTRVCTNPVATLLEWQDALCFIPVGSAAPQGSP

• Sequence length: 778

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31285897		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31198787		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31198787	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22997493	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29117881	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31285897		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24071868	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34287099	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30021381		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30021381, 32796815	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36938721	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36938721	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29117881, 30284652, 30854102		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31198787		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30284652		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31285897		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30431120		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29956806		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29956806, 30284652, 30431120, 30854102, 31198787		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37127623	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32541515	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29117881, 30284652, 30854102		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24071868	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30431120		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29956806		★☆☆☆☆ Found in Text Mining only