Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10023
Gene name	FRAT regulator of Wnt signaling pathway 1
Gene symbol	FRAT1
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10q24.1
Summary	The protein encoded by this gene belongs to the GSK-3-binding protein family. The protein inhibits GSK-3-mediated phosphorylation of beta-catenin and positively regulates the Wnt signaling pathway. It may function in tumor progression and in lymphomagenes

Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037726	hsa-miR-744-5p	CLASH	23622248
MIRT036909	hsa-miR-877-3p	CLASH	23622248
MIRT731516	hsa-miR-409-3p	Luciferase reporter assay	27037061
MIRT731516	hsa-miR-409-3p	Luciferase reporter assay	27037061
MIRT732324	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT732324	hsa-miR-34a-3p	Luciferase reporter assay	28340489
MIRT755429	hsa-miR-3648	Luciferase reporter assayWestern blottingqRT-PCR	36153370
MIRT1004074	hsa-miR-1272	CLIP-seq
MIRT1004075	hsa-miR-1288	CLIP-seq
MIRT1004076	hsa-miR-15a	CLIP-seq
MIRT1004077	hsa-miR-15b	CLIP-seq
MIRT1004078	hsa-miR-16	CLIP-seq
MIRT1004079	hsa-miR-195	CLIP-seq
MIRT1004080	hsa-miR-2467-3p	CLIP-seq
MIRT1004081	hsa-miR-3065-3p	CLIP-seq
MIRT1004082	hsa-miR-3117-3p	CLIP-seq
MIRT1004083	hsa-miR-3155	CLIP-seq
MIRT1004084	hsa-miR-3155b	CLIP-seq
MIRT1004085	hsa-miR-3158-5p	CLIP-seq
MIRT1004086	hsa-miR-3169	CLIP-seq
MIRT1004087	hsa-miR-3678-3p	CLIP-seq
MIRT1004088	hsa-miR-3914	CLIP-seq
MIRT1004089	hsa-miR-3928	CLIP-seq
MIRT1004090	hsa-miR-424	CLIP-seq
MIRT1004091	hsa-miR-4418	CLIP-seq
MIRT1004092	hsa-miR-4477a	CLIP-seq
MIRT1004093	hsa-miR-4503	CLIP-seq
MIRT1004094	hsa-miR-4537	CLIP-seq
MIRT1004095	hsa-miR-4661-3p	CLIP-seq
MIRT1004096	hsa-miR-4737	CLIP-seq
MIRT1004097	hsa-miR-4759	CLIP-seq
MIRT1004098	hsa-miR-484	CLIP-seq
MIRT1004099	hsa-miR-497	CLIP-seq
MIRT1004100	hsa-miR-509-3-5p	CLIP-seq
MIRT1004101	hsa-miR-509-5p	CLIP-seq
MIRT1004088	hsa-miR-3914	CLIP-seq
MIRT1004089	hsa-miR-3928	CLIP-seq
MIRT1004094	hsa-miR-4537	CLIP-seq
MIRT1997610	hsa-miR-1301	CLIP-seq
MIRT1997611	hsa-miR-3180	CLIP-seq
MIRT1997612	hsa-miR-3180-3p	CLIP-seq
MIRT1997613	hsa-miR-3196	CLIP-seq
MIRT1997614	hsa-miR-323-5p	CLIP-seq
MIRT1004088	hsa-miR-3914	CLIP-seq
MIRT1004089	hsa-miR-3928	CLIP-seq
MIRT1997615	hsa-miR-4479	CLIP-seq
MIRT1997616	hsa-miR-4528	CLIP-seq
MIRT1004094	hsa-miR-4537	CLIP-seq
MIRT1997617	hsa-miR-4660	CLIP-seq
MIRT1997618	hsa-miR-5047	CLIP-seq
MIRT1997619	hsa-miR-518a-5p	CLIP-seq
MIRT1997620	hsa-miR-527	CLIP-seq
MIRT2231267	hsa-miR-1303	CLIP-seq
MIRT2231268	hsa-miR-144	CLIP-seq
MIRT1004080	hsa-miR-2467-3p	CLIP-seq
MIRT2231269	hsa-miR-3124-5p	CLIP-seq
MIRT2231270	hsa-miR-3135b	CLIP-seq
MIRT2231271	hsa-miR-3174	CLIP-seq
MIRT2231272	hsa-miR-361-3p	CLIP-seq
MIRT2231273	hsa-miR-3616-3p	CLIP-seq
MIRT2231274	hsa-miR-3652	CLIP-seq
MIRT2231275	hsa-miR-4430	CLIP-seq
MIRT2231276	hsa-miR-4492	CLIP-seq
MIRT2231277	hsa-miR-4498	CLIP-seq
MIRT2231278	hsa-miR-4508	CLIP-seq
MIRT2231279	hsa-miR-4765	CLIP-seq
MIRT1997619	hsa-miR-518a-5p	CLIP-seq
MIRT1997620	hsa-miR-527	CLIP-seq
MIRT2231280	hsa-miR-567	CLIP-seq
MIRT2231281	hsa-miR-744	CLIP-seq
MIRT2231282	hsa-miR-762	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	10481074, 11738041, 12556519, 23455922, 23602568, 26496610, 29568061, 33961781
GO:0005634	Component	Nucleus	IDA	12223487
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12223487, 12556519
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0046825	Process	Regulation of protein export from nucleus	IDA	12223487
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	10428961
GO:0060070	Process	Canonical Wnt signaling pathway	IGI	12556519
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IBA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IGI	12556519
GO:0140678	Function	Molecular function inhibitor activity	IDA	10481074

MIM	HGNC	e!Ensembl
602503	3944	ENSG00000165879

Q92837

Protein name

Proto-oncogene FRAT1 (Frequently rearranged in advanced T-cell lymphomas 1) (FRAT-1)

Protein function

Positively regulates the Wnt signaling pathway by stabilizing beta-catenin through the association with GSK-3. May play a role in tumor progression and collaborate with PIM1 and MYC in lymphomagenesis.

PDB

1GNG , 3ZRK , 3ZRL , 3ZRM , 4AFJ , 5OY4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05350	GSK-3_bind	1 → 239	Glycogen synthase kinase-3 binding	Family

Sequence

MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSP
ASPCGPPGAPLRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGR
VRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASR
RLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGPL
SAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS

Sequence length

279

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway Alzheimer disease Pathways of neurodegeneration - multiple diseases Pathways in cancer Breast cancer Hepatocellular carcinoma Gastric cancer		Beta-catenin phosphorylation cascade Disassembly of the destruction complex and recruitment of AXIN to the membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (43)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	16479254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16479254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	27599661		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26178481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	26290361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11894125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26178481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21818639, 22528942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26178481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21818639		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11445844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11445844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11894125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	11894125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	18498136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23613813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23613813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23613813, 25922553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25922553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	26178481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27666874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26178481	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11894125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11894125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21818639, 22528942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21818639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27599661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11445844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11445844, 11894125, 21818639, 22528942, 25922553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11445844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	28340489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11445844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21818639, 22528942, 23613813, 27599661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21818639, 22528942, 31788970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	21818639		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16479254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26178481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27599661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34319909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11445844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36153370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	27037061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	26178481	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FRAT1 (FRAT regulator of Wnt signaling pathway 1)