INSL5 (insulin like 5)

Gene

• Entrez ID: 10022
• Gene name: Insulin like 5
• Gene symbol: INSL5
• Synonyms (NCBI Gene): PRO182, UNQ156
• Chromosome: 1
• Chromosome location: 1p31.3
• Summary: The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018088	hsa-miR-335-5p	Microarray	18185580
MIRT1067744	hsa-miR-141	CLIP-seq
MIRT1067745	hsa-miR-200a	CLIP-seq
MIRT1067746	hsa-miR-2682	CLIP-seq
MIRT1067747	hsa-miR-449c	CLIP-seq
MIRT1067748	hsa-miR-4514	CLIP-seq
MIRT1067749	hsa-miR-4645-5p	CLIP-seq
MIRT1067750	hsa-miR-4673	CLIP-seq
MIRT1067751	hsa-miR-4692	CLIP-seq
MIRT2552285	hsa-miR-182	CLIP-seq
MIRT2552286	hsa-miR-4470	CLIP-seq
MIRT2552285	hsa-miR-182	CLIP-seq
MIRT2552286	hsa-miR-4470	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007165	Process	Signal transduction	IEA
GO:2000253	Process	Positive regulation of feeding behavior	IBA
GO:2000253	Process	Positive regulation of feeding behavior	IEA

Other IDs

• MIM: 606413
• HGNC: 6088
• e!Ensembl: ENSG00000172410

Protein

• UniProt ID: Q9Y5Q6
• Protein name: Insulin-like peptide INSL5 (Insulin-like peptide 5) [Cleaved into: Insulin-like peptide INSL5 B chain; Insulin-like peptide INSL5 A chain]
• Protein function: May have a role in gut contractility or in thymic development and regulation. Activates RXFP4 with high potency and appears to be the endogenous ligand for this receptor.
• PDB: 2K1V, 2KBC, 7YJ4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00049	Insulin	26 → 135	Insulin/IGF/Relaxin family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in rectum with lower levels in uterus and ascending and descending colon. {ECO:0000269|PubMed:10458910}.
• Sequence:

  MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAE
  TGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTL
  CCTDGCSMTDLSALC

• Sequence length: 135

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Relaxin signaling pathway

Reactome:

G alpha (i) signalling events
Relaxin receptors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMBLYOPIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anorexia	Anorexia	BEFREE	31780677		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23438439		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34680872	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23438439		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31545476, 34419055	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	34680872	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31780677		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31780677		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	28627638	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	34493981	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	27243554		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23438439		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32657028	Stimulate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	23438439		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31348991		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29956214		★☆☆☆☆ Found in Text Mining only