Gene Gene information from NCBI Gene database.
Entrez ID 10018
Gene name BCL2 like 11
Gene symbol BCL2L11
Synonyms (NCBI Gene)
BAMBIMBOD
Chromosome 2
Chromosome location 2q13
Summary The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene
miRNA miRNA information provided by mirtarbase database.
1813
miRTarBase ID miRNA Experiments Reference
MIRT003739 hsa-miR-32-5p Luciferase reporter assay 18676839
MIRT003739 hsa-miR-32-5p qRT-PCR 18676839
MIRT001206 hsa-miR-17-5p Luciferase reporter assayWestern blot 19136465
MIRT001206 hsa-miR-17-5p Luciferase reporter assayWestern blot 19136465
MIRT001206 hsa-miR-17-5p Luciferase reporter assayWestern blot 19136465
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
CREB1 Unknown 20367563
FOXO3 Unknown 21654193
NFKB1 Repression 18223231
RELA Repression 18223231
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
71
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development IEA
GO:0001776 Process Leukocyte homeostasis IEA
GO:0001782 Process B cell homeostasis IEA
GO:0001822 Process Kidney development IEA
GO:0002260 Process Lymphocyte homeostasis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603827 994 ENSG00000153094
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43521
Protein name Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)
Protein function Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-ga
PDB 1F95 , 2K7W , 2NL9 , 2V6Q , 2VM6 , 2WH6 , 2YQ6 , 2YQ7 , 3D7V , 3FDL , 3IO8 , 3IO9 , 3KJ0 , 3KJ1 , 3KJ2 , 4A1U , 4A1W , 4B4S , 4D2M , 4QVF , 4UF3 , 4YJ4 , 4ZIE , 4ZIF , 4ZIH , 5AGW , 5AGX , 5C3G , 5VWV , 5VWW , 5VWX , 5VWY , 5VWZ , 5VX0 , 5VX2 , 5VX3 , 5WOS , 6QFI , 6RJP , 6TQQ , 6UA3 , 6UAB , 6VBX , 6X8O , 8T5E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06773 Bim_N 4 40 Bim protein N-terminus Family
PF08945 Bclx_interact 132 166 Bcl-x interacting, BH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are widely expressed with tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in sple
Sequence
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
MVILRLLRYIVRLVWRMH
Sequence length 198
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  EGFR tyrosine kinase inhibitor resistance
FoxO signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Apoptosis - multiple species
Non-alcoholic fatty liver disease
Epstein-Barr virus infection
Pathways in cancer
MicroRNAs in cancer
Colorectal cancer
  Activation of BIM and translocation to mitochondria
BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
NRAGE signals death through JNK
Signaling by BRAF and RAF fusions
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
RUNX3 regulates BCL2L11 (BIM) transcription
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
39
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 23908358, 25090024, 27095570, 28641145, 30537507
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 27144333, 31756944
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 17927446, 26639561, 29580739, 29767258
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of prostate Prostate adenocarcinoma BEFREE 31312023
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 16216913, 18509006, 24825889, 28181484
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 22399804
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 23908358, 25090024, 27095570, 28641145
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 24561519
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 32844279 Associate
★☆☆☆☆
Found in Text Mining only
Ameloblastoma Ameloblastoma BEFREE 28248452
★☆☆☆☆
Found in Text Mining only