BCL2L10 (BCL2 like 10)

Gene

• Entrez ID: 10017
• Gene name: BCL2 like 10
• Gene symbol: BCL2L10
• Synonyms (NCBI Gene): BCL-B, Boo, Diva, bcl2-L-10
• Chromosome: 15
• Chromosome location: 15q21.2
• Summary: The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438474	hsa-miR-18a-5p	Luciferase reporter assay	24184144
MIRT438474	hsa-miR-18a-5p	Luciferase reporter assay	24184144
MIRT818595	hsa-miR-1228	CLIP-seq
MIRT818596	hsa-miR-1275	CLIP-seq
MIRT818597	hsa-miR-18a	CLIP-seq
MIRT818598	hsa-miR-18b	CLIP-seq
MIRT818599	hsa-miR-1911	CLIP-seq
MIRT818600	hsa-miR-3160-5p	CLIP-seq
MIRT818601	hsa-miR-342-5p	CLIP-seq
MIRT818602	hsa-miR-3622a-3p	CLIP-seq
MIRT818603	hsa-miR-3622b-3p	CLIP-seq
MIRT818604	hsa-miR-4271	CLIP-seq
MIRT818605	hsa-miR-4446-5p	CLIP-seq
MIRT818606	hsa-miR-4447	CLIP-seq
MIRT818607	hsa-miR-4457	CLIP-seq
MIRT818608	hsa-miR-4472	CLIP-seq
MIRT818609	hsa-miR-4525	CLIP-seq
MIRT818610	hsa-miR-4651	CLIP-seq
MIRT818611	hsa-miR-4664-5p	CLIP-seq
MIRT818612	hsa-miR-4665-5p	CLIP-seq
MIRT818613	hsa-miR-4723-5p	CLIP-seq
MIRT818614	hsa-miR-4725-3p	CLIP-seq
MIRT818615	hsa-miR-4735-3p	CLIP-seq
MIRT818616	hsa-miR-4747-5p	CLIP-seq
MIRT818617	hsa-miR-4755-5p	CLIP-seq
MIRT818618	hsa-miR-513b	CLIP-seq
MIRT818619	hsa-miR-608	CLIP-seq
MIRT818620	hsa-miR-625	CLIP-seq
MIRT818621	hsa-miR-642a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001836	Process	Release of cytochrome c from mitochondria	IBA
GO:0005509	Function	Calcium ion binding	IMP	21705382
GO:0005515	Function	Protein binding	IPI	11278245, 17532299, 19255499, 22233804, 22498477, 23235460, 23563182, 27995898, 32296183, 33961781, 34245648
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	11278245, 22233804, 22498477, 23563182
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	22498477
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005819	Component	Spindle	IEA
GO:0005819	Component	Spindle	ISS
GO:0005829	Component	Cytosol	IDA	11278245
GO:0005856	Component	Cytoskeleton	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	27995898
GO:0007283	Process	Spermatogenesis	TAS	9878060
GO:0007292	Process	Female gamete generation	TAS	9878060
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA
GO:0015267	Function	Channel activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9878060
GO:0031023	Process	Microtubule organizing center organization	ISS
GO:0031965	Component	Nuclear membrane	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	11278245
GO:0044233	Component	Mitochondria-associated endoplasmic reticulum membrane contact site	IDA	27995898
GO:0055085	Process	Transmembrane transport	IEA
GO:0089720	Function	Caspase binding	IPI	19255499
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IBA

Other IDs

• MIM: 606910
• HGNC: 993
• e!Ensembl: ENSG00000137875

Protein

• UniProt ID: Q9HD36
• Protein name: Bcl-2-like protein 10 (Bcl2-L-10) (Anti-apoptotic protein Boo) (Anti-apoptotic protein NrH) (Apoptosis regulator Bcl-B)
• Protein function: Promotes cell survival by suppressing apoptosis induced by BAX but not BAK (PubMed:11278245, PubMed:11689480). Increases binding of AHCYL1/IRBIT to ITPR1 (PubMed:27995898). Reduces ITPR1-mediated calcium release from the endoplasmic reticulum co
• PDB: 4B4S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00452	Bcl-2	49 → 163	Apoptosis regulator proteins, Bcl-2 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed in adult tissues. Preferentially expressed in lung, liver and kidney. {ECO:0000269|PubMed:11593390}.
• Sequence:

  MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIH
  RSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKK
  WGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWR
  KQLVQAFLSCLLTTAFIYLWTRLL

• Sequence length: 204

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	21077739		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	22577154		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	18483366		★☆☆☆☆ Found in Text Mining only
Affective Disorders, Psychotic	Affective Psychosis	BEFREE	27260655		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30583265		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24184144		★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	30325606		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18483366, 29330143		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18483366, 37391438	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	18483366	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29330143		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30696802	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18483366		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18483366, 37391438	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18483366		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	18483366		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11557035	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18483366	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37391438	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22577154, 23563182, 28514758, 37391438	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21077739, 22577154, 28514758		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27770580, 28259820, 30519035		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37391438	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	18483366		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18483366, 29330143		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18483366		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18483366		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20428828		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18483366, 22233804, 24047476, 27770580, 29330143		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	22577154, 24047476, 31375393		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18483366		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22577154, 24047476, 28514758, 31375393		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22577154, 28514758	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18483366, 21077739, 21171085, 24047476, 28259820		★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	BEFREE	28969876		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33649794	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18483366		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18483366	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29808940		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	18483366	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20428828, 21171085		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	18483366	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18483366	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	24184144		★☆☆☆☆ Found in Text Mining only