Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10016
Gene name	Programmed cell death 6
Gene symbol	PDCD6
Synonyms (NCBI Gene)	ALG-2ALG2PEF1B
Chromosome	5
Chromosome location	5p15.33
Summary	This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T

157

Show/Hide all (157)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005725	hsa-miR-183-5p	qRT-PCR	20602797
MIRT040945	hsa-miR-18a-3p	CLASH	23622248
MIRT440016	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440016	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1219454	hsa-miR-1207-3p	CLIP-seq
MIRT1219455	hsa-miR-137	CLIP-seq
MIRT1219456	hsa-miR-183	CLIP-seq
MIRT1219457	hsa-miR-21	CLIP-seq
MIRT1219458	hsa-miR-218	CLIP-seq
MIRT1219459	hsa-miR-3124-3p	CLIP-seq
MIRT1219460	hsa-miR-338-5p	CLIP-seq
MIRT1219461	hsa-miR-346	CLIP-seq
MIRT1219462	hsa-miR-412	CLIP-seq
MIRT1219463	hsa-miR-4286	CLIP-seq
MIRT1219464	hsa-miR-4288	CLIP-seq
MIRT1219465	hsa-miR-4504	CLIP-seq
MIRT1219466	hsa-miR-4509	CLIP-seq
MIRT1219467	hsa-miR-4666-3p	CLIP-seq
MIRT1219468	hsa-miR-4684-3p	CLIP-seq
MIRT1219469	hsa-miR-4704-3p	CLIP-seq
MIRT1219470	hsa-miR-4716-5p	CLIP-seq
MIRT1219471	hsa-miR-4744	CLIP-seq
MIRT1219472	hsa-miR-4773	CLIP-seq
MIRT1219473	hsa-miR-4777-3p	CLIP-seq
MIRT1219474	hsa-miR-518a-5p	CLIP-seq
MIRT1219475	hsa-miR-527	CLIP-seq
MIRT1219476	hsa-miR-548aa	CLIP-seq
MIRT1219477	hsa-miR-582-5p	CLIP-seq
MIRT1219478	hsa-miR-587	CLIP-seq
MIRT1219479	hsa-miR-590-5p	CLIP-seq
MIRT1219480	hsa-miR-598	CLIP-seq
MIRT1219481	hsa-miR-632	CLIP-seq
MIRT1219482	hsa-miR-654-3p	CLIP-seq
MIRT1219483	hsa-miR-662	CLIP-seq
MIRT1219454	hsa-miR-1207-3p	CLIP-seq
MIRT1219463	hsa-miR-4286	CLIP-seq
MIRT1219454	hsa-miR-1207-3p	CLIP-seq
MIRT2063428	hsa-miR-136	CLIP-seq
MIRT1219455	hsa-miR-137	CLIP-seq
MIRT2063429	hsa-miR-1914	CLIP-seq
MIRT1219457	hsa-miR-21	CLIP-seq
MIRT1219458	hsa-miR-218	CLIP-seq
MIRT1219459	hsa-miR-3124-3p	CLIP-seq
MIRT2063430	hsa-miR-3130-3p	CLIP-seq
MIRT1219460	hsa-miR-338-5p	CLIP-seq
MIRT1219461	hsa-miR-346	CLIP-seq
MIRT2063431	hsa-miR-3914	CLIP-seq
MIRT2063432	hsa-miR-3938	CLIP-seq
MIRT1219462	hsa-miR-412	CLIP-seq
MIRT1219464	hsa-miR-4288	CLIP-seq
MIRT1219465	hsa-miR-4504	CLIP-seq
MIRT1219467	hsa-miR-4666-3p	CLIP-seq
MIRT1219469	hsa-miR-4704-3p	CLIP-seq
MIRT1219470	hsa-miR-4716-5p	CLIP-seq
MIRT1219472	hsa-miR-4773	CLIP-seq
MIRT2063433	hsa-miR-507	CLIP-seq
MIRT2063434	hsa-miR-542-3p	CLIP-seq
MIRT2063435	hsa-miR-557	CLIP-seq
MIRT1219478	hsa-miR-587	CLIP-seq
MIRT1219479	hsa-miR-590-5p	CLIP-seq
MIRT1219480	hsa-miR-598	CLIP-seq
MIRT1219481	hsa-miR-632	CLIP-seq
MIRT2063436	hsa-miR-642a	CLIP-seq
MIRT1219482	hsa-miR-654-3p	CLIP-seq
MIRT1219454	hsa-miR-1207-3p	CLIP-seq
MIRT1219455	hsa-miR-137	CLIP-seq
MIRT1219456	hsa-miR-183	CLIP-seq
MIRT2291895	hsa-miR-204	CLIP-seq
MIRT1219457	hsa-miR-21	CLIP-seq
MIRT2291896	hsa-miR-211	CLIP-seq
MIRT2063430	hsa-miR-3130-3p	CLIP-seq
MIRT2291897	hsa-miR-3143	CLIP-seq
MIRT2291898	hsa-miR-323-3p	CLIP-seq
MIRT1219460	hsa-miR-338-5p	CLIP-seq
MIRT1219461	hsa-miR-346	CLIP-seq
MIRT2063432	hsa-miR-3938	CLIP-seq
MIRT1219463	hsa-miR-4286	CLIP-seq
MIRT1219464	hsa-miR-4288	CLIP-seq
MIRT2291899	hsa-miR-4325	CLIP-seq
MIRT2291900	hsa-miR-4422	CLIP-seq
MIRT1219465	hsa-miR-4504	CLIP-seq
MIRT1219466	hsa-miR-4509	CLIP-seq
MIRT1219467	hsa-miR-4666-3p	CLIP-seq
MIRT1219469	hsa-miR-4704-3p	CLIP-seq
MIRT1219471	hsa-miR-4744	CLIP-seq
MIRT2291901	hsa-miR-4755-5p	CLIP-seq
MIRT1219472	hsa-miR-4773	CLIP-seq
MIRT1219473	hsa-miR-4777-3p	CLIP-seq
MIRT2291902	hsa-miR-494	CLIP-seq
MIRT2063433	hsa-miR-507	CLIP-seq
MIRT2291903	hsa-miR-543	CLIP-seq
MIRT1219476	hsa-miR-548aa	CLIP-seq
MIRT2063435	hsa-miR-557	CLIP-seq
MIRT1219479	hsa-miR-590-5p	CLIP-seq
MIRT1219480	hsa-miR-598	CLIP-seq
MIRT2291904	hsa-miR-623	CLIP-seq
MIRT1219481	hsa-miR-632	CLIP-seq
MIRT1219482	hsa-miR-654-3p	CLIP-seq
MIRT1219483	hsa-miR-662	CLIP-seq
MIRT1219457	hsa-miR-21	CLIP-seq
MIRT1219458	hsa-miR-218	CLIP-seq
MIRT1219459	hsa-miR-3124-3p	CLIP-seq
MIRT1219462	hsa-miR-412	CLIP-seq
MIRT1219470	hsa-miR-4716-5p	CLIP-seq
MIRT1219478	hsa-miR-587	CLIP-seq
MIRT1219479	hsa-miR-590-5p	CLIP-seq
MIRT1219461	hsa-miR-346	CLIP-seq
MIRT1219464	hsa-miR-4288	CLIP-seq
MIRT1219481	hsa-miR-632	CLIP-seq
MIRT1219482	hsa-miR-654-3p	CLIP-seq
MIRT2063428	hsa-miR-136	CLIP-seq
MIRT1219456	hsa-miR-183	CLIP-seq
MIRT2063429	hsa-miR-1914	CLIP-seq
MIRT1219458	hsa-miR-218	CLIP-seq
MIRT1219459	hsa-miR-3124-3p	CLIP-seq
MIRT2063430	hsa-miR-3130-3p	CLIP-seq
MIRT2291898	hsa-miR-323-3p	CLIP-seq
MIRT1219461	hsa-miR-346	CLIP-seq
MIRT2063432	hsa-miR-3938	CLIP-seq
MIRT1219462	hsa-miR-412	CLIP-seq
MIRT1219464	hsa-miR-4288	CLIP-seq
MIRT1219466	hsa-miR-4509	CLIP-seq
MIRT1219469	hsa-miR-4704-3p	CLIP-seq
MIRT1219470	hsa-miR-4716-5p	CLIP-seq
MIRT1219471	hsa-miR-4744	CLIP-seq
MIRT1219472	hsa-miR-4773	CLIP-seq
MIRT1219473	hsa-miR-4777-3p	CLIP-seq
MIRT2291902	hsa-miR-494	CLIP-seq
MIRT1219478	hsa-miR-587	CLIP-seq
MIRT1219481	hsa-miR-632	CLIP-seq
MIRT2063436	hsa-miR-642a	CLIP-seq
MIRT1219482	hsa-miR-654-3p	CLIP-seq
MIRT2589569	hsa-miR-760	CLIP-seq
MIRT2063428	hsa-miR-136	CLIP-seq
MIRT1219456	hsa-miR-183	CLIP-seq
MIRT2063429	hsa-miR-1914	CLIP-seq
MIRT1219458	hsa-miR-218	CLIP-seq
MIRT1219459	hsa-miR-3124-3p	CLIP-seq
MIRT2063430	hsa-miR-3130-3p	CLIP-seq
MIRT2291898	hsa-miR-323-3p	CLIP-seq
MIRT1219461	hsa-miR-346	CLIP-seq
MIRT2063431	hsa-miR-3914	CLIP-seq
MIRT2063432	hsa-miR-3938	CLIP-seq
MIRT1219462	hsa-miR-412	CLIP-seq
MIRT1219464	hsa-miR-4288	CLIP-seq
MIRT1219466	hsa-miR-4509	CLIP-seq
MIRT1219469	hsa-miR-4704-3p	CLIP-seq
MIRT1219470	hsa-miR-4716-5p	CLIP-seq
MIRT1219471	hsa-miR-4744	CLIP-seq
MIRT1219472	hsa-miR-4773	CLIP-seq
MIRT1219473	hsa-miR-4777-3p	CLIP-seq
MIRT2291902	hsa-miR-494	CLIP-seq
MIRT1219478	hsa-miR-587	CLIP-seq
MIRT1219481	hsa-miR-632	CLIP-seq
MIRT2063436	hsa-miR-642a	CLIP-seq
MIRT1219482	hsa-miR-654-3p	CLIP-seq
MIRT2589569	hsa-miR-760	CLIP-seq

Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IEA
GO:0000287	Function	Magnesium ion binding	ISS
GO:0001525	Process	Angiogenesis	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	21893193
GO:0005509	Function	Calcium ion binding	IDA	25667979
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS
GO:0005515	Function	Protein binding	IPI	11883939, 12445460, 16132846, 16189514, 17174262, 17196169, 18256029, 18940611, 21893193, 21988832, 23924735, 25416956, 25667979, 25910212, 26950892, 27716508, 27784779, 27813252, 31515488, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	11278427, 16957052, 17045351, 17196169, 21122810, 27784779
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	11278427, 14999017, 17045351, 17196169, 21122810, 27784779
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	17196169
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006886	Process	Intracellular protein transport	IDA	21122810
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	27716508, 27813252
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	21893193
GO:0012507	Component	ER to Golgi transport vesicle membrane	IEA
GO:0014029	Process	Neural crest formation	IMP	27716508
GO:0014032	Process	Neural crest cell development	IMP	27716508
GO:0016020	Component	Membrane	IEA
GO:0030127	Component	COPII vesicle coat	IDA	27716508
GO:0030674	Function	Protein-macromolecule adaptor activity	IMP	19520058
GO:0030948	Process	Negative regulation of vascular endothelial growth factor receptor signaling pathway	IDA	21893193
GO:0031410	Component	Cytoplasmic vesicle	IDA	21122810
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IDA	27716508
GO:0032007	Process	Negative regulation of TOR signaling	IDA	21893193
GO:0034605	Process	Cellular response to heat	IDA	21122810
GO:0036324	Process	Vascular endothelial growth factor receptor-2 signaling pathway	IDA	21893193
GO:0042802	Function	Identical protein binding	IPI	16189514, 18940611, 21988832, 25416956
GO:0042803	Function	Protein homodimerization activity	IDA	25667979
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16132846
GO:0043495	Function	Protein-membrane adaptor activity	IMP	16957052
GO:0045766	Process	Positive regulation of angiogenesis	IDA	21893193
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	11278427
GO:0046983	Function	Protein dimerization activity	IEA
GO:0046983	Function	Protein dimerization activity	IPI	11883899
GO:0048208	Process	COPII vesicle coating	IMP	27716508
GO:0048306	Function	Calcium-dependent protein binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IMP	14999017
GO:0048306	Function	Calcium-dependent protein binding	IPI	12445460, 16957052, 17045351, 17196169, 17214967, 18256029, 23924735, 27716508
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	17196169
GO:0051592	Process	Response to calcium ion	IDA	12445460, 17196169
GO:0051592	Process	Response to calcium ion	IEA
GO:0051592	Process	Response to calcium ion	ISS
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	21893193
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070971	Component	Endoplasmic reticulum exit site	IDA	27813252
GO:0070971	Component	Endoplasmic reticulum exit site	IMP	16957052
GO:0097190	Process	Apoptotic signaling pathway	TAS	8560270
GO:1902527	Process	Positive regulation of protein monoubiquitination	IMP	27716508
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IMP	27716508

MIM	HGNC	e!Ensembl
601057	8765	ENSG00000249915

O75340

Protein name

Programmed cell death protein 6 (Apoptosis-linked gene 2 protein homolog) (ALG-2)

Protein function

Calcium sensor that plays a key role in processes such as endoplasmic reticulum (ER)-Golgi vesicular transport, endosomal biogenesis or membrane repair. Acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein comple

PDB

2ZN8 , 2ZN9 , 2ZND , 2ZNE , 2ZRS , 2ZRT , 3AAJ , 3AAK , 3WXA , 5GQQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13202	EF-hand_5	30 → 53	EF hand	Domain
PF13499	EF-hand_7	92 → 156	EF-hand domain pair	Domain

Sequence

MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPF
NPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALS
GFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSY
EQYLSMVFSIV

Sequence length

191

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOGENOUS DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18632575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24792888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27926525, 29387242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35732318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22161137, 22412903, 37005078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37005078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24792888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23167403, 28004381, 31496727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22369209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22369209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	27738758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29672642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19383317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26678268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	29805523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	19955554	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	PSYGENET_DG	19955554		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	23137875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22369209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31128039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31128039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31128039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28300556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28300556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	36788145	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	29672642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12819013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23167403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31496727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27926525, 29387242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31128039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23167403, 28004381, 31496727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18957060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24792888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22142513, 22369209, 27738758, 27926525, 28004381, 29872511, 30240438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19383317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29387242		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15366927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	35732318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	29672642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	29672642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19383317, 22369209, 23167403, 27926525, 28300556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23167403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22369209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18957060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18957060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18957060, 22161137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	32901835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24792888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	23551056		★★★★★ ★☆☆☆☆ Found in Text Mining only

PDCD6 (programmed cell death 6)