HDAC5 (histone deacetylase 5)

Gene

• Entrez ID: 10014
• Gene name: Histone deacetylase 5
• Gene symbol: HDAC5
• Synonyms (NCBI Gene): HD5, NY-CO-9
• Chromosome: 17
• Chromosome location: 17q21.31
• Summary: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene b

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029704	hsa-miR-26b-5p	Microarray	19088304
MIRT052514	hsa-let-7a-5p	CLASH	23622248
MIRT491540	hsa-miR-4476	PAR-CLIP	23592263
MIRT491541	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT491539	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT491538	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT491537	hsa-miR-8089	PAR-CLIP	23592263
MIRT491536	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT491535	hsa-miR-4533	PAR-CLIP	23592263
MIRT491534	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT491533	hsa-miR-765	PAR-CLIP	23592263
MIRT491531	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT491532	hsa-miR-3175	PAR-CLIP	23592263
MIRT491530	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT491529	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT491528	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491527	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT491526	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT491525	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT733621	hsa-miR-185-5p	Microarray	34012635
MIRT733621	hsa-miR-185-5p	Microarray	34012635
MIRT733850	hsa-miR-134-5p	Luciferase reporter assay, Microarray, Western blotting	32783377
MIRT735592	hsa-miR-423-3p	Western blotting, Immunohistochemistry (IHC), qRT-PCR	32089706
MIRT491540	hsa-miR-4476	PAR-CLIP	23592263
MIRT491541	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT491539	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT491538	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT491537	hsa-miR-8089	PAR-CLIP	23592263
MIRT491536	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT491535	hsa-miR-4533	PAR-CLIP	23592263
MIRT491534	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT491533	hsa-miR-765	PAR-CLIP	23592263
MIRT491531	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT491532	hsa-miR-3175	PAR-CLIP	23592263
MIRT491530	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT491529	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT491528	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491527	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT491526	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT491525	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT756180	hsa-miR-4256	Luciferase reporter assay, Western blotting, qRT-PCR, ChIP-seq	37415735
MIRT1042481	hsa-miR-1224-3p	CLIP-seq
MIRT1042482	hsa-miR-1302	CLIP-seq
MIRT1042483	hsa-miR-24	CLIP-seq
MIRT1042484	hsa-miR-3065-3p	CLIP-seq
MIRT1042485	hsa-miR-3126-5p	CLIP-seq
MIRT1042486	hsa-miR-4283	CLIP-seq
MIRT1042487	hsa-miR-4298	CLIP-seq
MIRT1042488	hsa-miR-4434	CLIP-seq
MIRT1042489	hsa-miR-4437	CLIP-seq
MIRT1042490	hsa-miR-4489	CLIP-seq
MIRT1042491	hsa-miR-4516	CLIP-seq
MIRT1042492	hsa-miR-4531	CLIP-seq
MIRT1042493	hsa-miR-4643	CLIP-seq
MIRT1042494	hsa-miR-4717-3p	CLIP-seq
MIRT1042495	hsa-miR-4723-5p	CLIP-seq
MIRT1042496	hsa-miR-4728-5p	CLIP-seq
MIRT1042497	hsa-miR-642b	CLIP-seq
MIRT1042498	hsa-miR-661	CLIP-seq
MIRT1042488	hsa-miR-4434	CLIP-seq
MIRT1042491	hsa-miR-4516	CLIP-seq
MIRT1042492	hsa-miR-4531	CLIP-seq
MIRT1042499	hsa-miR-520d-5p	CLIP-seq
MIRT1042500	hsa-miR-524-5p	CLIP-seq
MIRT2008999	hsa-miR-4640-3p	CLIP-seq
MIRT2009000	hsa-miR-4667-3p	CLIP-seq
MIRT2241348	hsa-miR-1270	CLIP-seq
MIRT2241349	hsa-miR-1291	CLIP-seq
MIRT2241350	hsa-miR-3151	CLIP-seq
MIRT2241351	hsa-miR-3160-3p	CLIP-seq
MIRT2241352	hsa-miR-3190	CLIP-seq
MIRT2241353	hsa-miR-4254	CLIP-seq
MIRT2241354	hsa-miR-4308	CLIP-seq
MIRT2008999	hsa-miR-4640-3p	CLIP-seq
MIRT2241355	hsa-miR-4683	CLIP-seq
MIRT2241356	hsa-miR-4777-5p	CLIP-seq
MIRT2241357	hsa-miR-4786-3p	CLIP-seq
MIRT2241358	hsa-miR-509-3p	CLIP-seq
MIRT2241359	hsa-miR-518d-5p	CLIP-seq
MIRT2241360	hsa-miR-519b-5p	CLIP-seq
MIRT2241361	hsa-miR-519c-5p	CLIP-seq
MIRT2241362	hsa-miR-520c-5p	CLIP-seq
MIRT2241363	hsa-miR-526a	CLIP-seq
MIRT2241364	hsa-miR-541	CLIP-seq
MIRT2241365	hsa-miR-620	CLIP-seq
MIRT2241366	hsa-miR-654-5p	CLIP-seq
MIRT2241367	hsa-miR-671-5p	CLIP-seq
MIRT2241368	hsa-miR-939	CLIP-seq
MIRT2451044	hsa-miR-103a	CLIP-seq
MIRT2451045	hsa-miR-107	CLIP-seq
MIRT2451046	hsa-miR-1913	CLIP-seq
MIRT2451047	hsa-miR-3127-3p	CLIP-seq
MIRT2451048	hsa-miR-324-3p	CLIP-seq
MIRT2451049	hsa-miR-4713-5p	CLIP-seq
MIRT2451050	hsa-miR-4749-3p	CLIP-seq
MIRT2545031	hsa-miR-4419a	CLIP-seq
MIRT2545032	hsa-miR-4510	CLIP-seq
MIRT2545033	hsa-miR-4690-5p	CLIP-seq
MIRT2241356	hsa-miR-4777-5p	CLIP-seq
MIRT2241359	hsa-miR-518d-5p	CLIP-seq
MIRT2241360	hsa-miR-519b-5p	CLIP-seq
MIRT2241361	hsa-miR-519c-5p	CLIP-seq
MIRT2241362	hsa-miR-520c-5p	CLIP-seq
MIRT2241363	hsa-miR-526a	CLIP-seq
MIRT2545031	hsa-miR-4419a	CLIP-seq
MIRT2545032	hsa-miR-4510	CLIP-seq
MIRT2545033	hsa-miR-4690-5p	CLIP-seq
MIRT2241356	hsa-miR-4777-5p	CLIP-seq
MIRT2241359	hsa-miR-518d-5p	CLIP-seq
MIRT2241360	hsa-miR-519b-5p	CLIP-seq
MIRT2241361	hsa-miR-519c-5p	CLIP-seq
MIRT2241362	hsa-miR-520c-5p	CLIP-seq
MIRT2241363	hsa-miR-526a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IBA
GO:0000118	Component	Histone deacetylase complex	TAS	12711221
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16236793
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	10869435
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	10983972, 19351956, 23867755
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	19351956
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	24413532
GO:0001216	Function	DNA-binding transcription activator activity	IMP	19071119
GO:0001222	Function	Transcription corepressor binding	IPI	10898795
GO:0003682	Function	Chromatin binding	IEA
GO:0004407	Function	Histone deacetylase activity	IBA
GO:0004407	Function	Histone deacetylase activity	IDA	10869435
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0005080	Function	Protein kinase C binding	IPI	20188095
GO:0005515	Function	Protein binding	IPI	10869435, 15161933, 15194749, 15923258, 16919237, 17075044, 17872950, 18711143, 19071119, 19666599, 20211142, 22649097, 23752268, 24229708, 24413532, 25752541, 28514442, 32296183, 33961781, 35044719, 35271311
GO:0005634	Component	Nucleus	IDA	10869435, 11081517, 23867755, 26157139
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10869435, 11081517, 26157139
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006954	Process	Inflammatory response	TAS	12711221
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0010830	Process	Regulation of myotube differentiation	ISS
GO:0010832	Process	Negative regulation of myotube differentiation	IMP	10983972, 11081517
GO:0014823	Process	Response to activity	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030183	Process	B cell differentiation	TAS	12711221
GO:0032869	Process	Cellular response to insulin stimulus	NAS	18184930
GO:0032991	Component	Protein-containing complex	IEA
GO:0033558	Function	Protein lysine deacetylase activity	IEA
GO:0033558	Function	Protein lysine deacetylase activity	IMP	23867755
GO:0040029	Process	Epigenetic regulation of gene expression	IBA
GO:0042113	Process	B cell activation	TAS	12711221
GO:0042220	Process	Response to cocaine	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042826	Function	Histone deacetylase binding	IPI	23867755
GO:0045814	Process	Negative regulation of gene expression, epigenetic	NAS	24413532
GO:0045892	Process	Negative regulation of DNA-templated transcription	TAS	12711221
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19071119
GO:0046872	Function	Metal ion binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	19071119, 20408817, 23867755
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IMP	19351956
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	12242305
GO:0141221	Function	Histone deacetylase activity, hydrolytic mechanism	IEA

Other IDs

• MIM: 605315
• HGNC: 14068
• e!Ensembl: ENSG00000108840

Protein

• UniProt ID: Q9UQL6
• Protein name: Histone deacetylase 5 (HD5) (EC 3.5.1.98) (Antigen NY-CO-9)
• Protein function: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell c
• PDB: 5UWI, 8Q9P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12203	HDAC4_Gln	67 → 164	Glutamine rich N terminal domain of histone deacetylase 4	Family
  PF00850	Hist_deacetyl	704 → 1022	Histone deacetylase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELR
  GALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
  QEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIAS
  TEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKL
  PLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
  TGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQ
  FSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST
  SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATS
  MRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGE
  LPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
  CIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQ
  SSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQE
  TGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLP
  CGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM
  GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNF
  FPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVS
  AGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVS
  ALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGET
  EEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL

• Sequence length: 1122

Pathways

KEGG:

Apelin signaling pathway
Neutrophil extracellular trap formation
Alcoholism
Viral carcinogenesis
MicroRNAs in cancer

Reactome:

Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Notch-HLH transcription pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL PRIMARY PULMONARY HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY HYPERTENSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, SYSTEMIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	20636436		★☆☆☆☆ Found in Text Mining only
Adjustment Disorders	Adjustment Disorders	CTD_human_DG	17988634		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	20413433		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	30190424		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30483749		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	34036344	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31257501		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	31001930		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	31001930	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31001930		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20042720, 30793765		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23632129, 25452308	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21508384		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20042720, 30793765		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20042720	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30321539		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	35756425	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	31043756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31043756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	22199269, 27177225, 27212032, 29633255, 31690832		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27177225, 31690832	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27212032	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24092570, 27246208	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24706304, 28653891	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29620443, 30066893		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32341020, 36102738	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24191246	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29907596		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	20413433		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	23893747	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	23275209, 28526090		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32711442, 33673279	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	18218981, 21768220		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30110565		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36175163	Associate	★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	31043756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	16501568, 24495952		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	38242038	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	36360783	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	28235630		★☆☆☆☆ Found in Text Mining only
Familial primary pulmonary hypertension	Pulmonary Hypertension	CTD_human_DG	22711276		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	29229738		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21508384		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21508384		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25050565, 26261519		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25791281, 26261519, 35545840, 37528157	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	22865920, 27177225, 27246208	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	27177225		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	18218981, 21768220		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	36293392	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	37632052	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28567090		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	35756425	Associate	★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	27436825		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26061431, 28653891	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	CTD_human_DG	22711276		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	29339432		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37108600	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30851335		★☆☆☆☆ Found in Text Mining only
LEPTIN RECEPTOR DEFICIENCY	LEPTIN RECEPTOR DEFICIENCY	BEFREE	27614433		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22322234, 24706304, 25129440, 28653891, 29637001, 30151243		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	17258370, 28260899		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	17258370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	22199269, 27177225, 27212032, 29633255, 31690832		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29620443, 30066893		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30250993, 30537988		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23812427, 25129440, 28440397, 29633255, 30066893, 31052182		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22199269, 27177225, 27212032		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	20413433		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	16501568, 24495952		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	25482492	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	36352383	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22199269, 28414307, 28440397, 31052182		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	26847592		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23812427, 27572323		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	28235630		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28235630		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28440397		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35469824	Stimulate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29326587		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	GENOMICS_ENGLAND_DG	26723575		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	31499747	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23729589	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24092570		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24092570	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32199224	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20128820, 36102738	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	31059522		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37478850	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	15888697	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28526090	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Hypertension, Primary, 1	Pulmonary Hypertension	CTD_human_DG	22711276		★☆☆☆☆ Found in Text Mining only
Pulmonary Hypertension, Primary, 1, With Hereditary Hemorrhagic Telangiectasia	Pulmonary Hypertension With Hereditary Hemorrhagic Telangiectasia	CTD_human_DG	22711276		★☆☆☆☆ Found in Text Mining only
Reactive depression	Reactive Depression	CTD_human_DG	17988634		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25452308		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	27482699, 30884213		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31002870		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	24191246		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29229738		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30250993, 30537988		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35725010, 37415735	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	27482699, 30884213		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	CTD_human_DG	27482699		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transient Situational Disturbance	Transient Situational Disturbance	CTD_human_DG	17988634		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	17258370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	17258370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	31052182		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	36293392	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30793765		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	36430854	Inhibit	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	20519629	Associate	★☆☆☆☆ Found in Text Mining only