CD24 (CD24 molecule)

Gene

• Entrez ID: 100133941
• Gene name: CD24 molecule
• Gene symbol: CD24
• Synonyms (NCBI Gene): CD24A
• Chromosome: 6
• Chromosome location: 6q21
• Summary: This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a gl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002501	hsa-miR-373-3p	Microarray	15685193
MIRT053047	hsa-miR-34a-5p	Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR	23533633
MIRT756302	hsa-miR-181a-3p	Luciferase reporter assay	38030594
MIRT874174	hsa-miR-101	CLIP-seq
MIRT874175	hsa-miR-1178	CLIP-seq
MIRT874176	hsa-miR-1179	CLIP-seq
MIRT874177	hsa-miR-1206	CLIP-seq
MIRT874178	hsa-miR-1207-5p	CLIP-seq
MIRT874179	hsa-miR-122	CLIP-seq
MIRT874180	hsa-miR-1224-5p	CLIP-seq
MIRT874181	hsa-miR-1225-3p	CLIP-seq
MIRT874182	hsa-miR-1233	CLIP-seq
MIRT874183	hsa-miR-1237	CLIP-seq
MIRT874184	hsa-miR-1243	CLIP-seq
MIRT874185	hsa-miR-1246	CLIP-seq
MIRT874186	hsa-miR-1248	CLIP-seq
MIRT874187	hsa-miR-1261	CLIP-seq
MIRT874188	hsa-miR-1269	CLIP-seq
MIRT874189	hsa-miR-1269b	CLIP-seq
MIRT874190	hsa-miR-1285	CLIP-seq
MIRT874191	hsa-miR-129-5p	CLIP-seq
MIRT874192	hsa-miR-1298	CLIP-seq
MIRT874193	hsa-miR-1299	CLIP-seq
MIRT874194	hsa-miR-1323	CLIP-seq
MIRT874195	hsa-miR-144	CLIP-seq
MIRT874196	hsa-miR-145	CLIP-seq
MIRT874197	hsa-miR-1468	CLIP-seq
MIRT874198	hsa-miR-146b-3p	CLIP-seq
MIRT874199	hsa-miR-181a	CLIP-seq
MIRT874200	hsa-miR-181b	CLIP-seq
MIRT874201	hsa-miR-181c	CLIP-seq
MIRT874202	hsa-miR-181d	CLIP-seq
MIRT874203	hsa-miR-1827	CLIP-seq
MIRT874204	hsa-miR-186	CLIP-seq
MIRT874205	hsa-miR-203	CLIP-seq
MIRT874206	hsa-miR-2052	CLIP-seq
MIRT874207	hsa-miR-2115	CLIP-seq
MIRT874208	hsa-miR-2277-5p	CLIP-seq
MIRT874209	hsa-miR-298	CLIP-seq
MIRT874210	hsa-miR-300	CLIP-seq
MIRT874211	hsa-miR-302a	CLIP-seq
MIRT874212	hsa-miR-302b	CLIP-seq
MIRT874213	hsa-miR-302c	CLIP-seq
MIRT874214	hsa-miR-302d	CLIP-seq
MIRT874215	hsa-miR-302e	CLIP-seq
MIRT874216	hsa-miR-3064-3p	CLIP-seq
MIRT874217	hsa-miR-3065-5p	CLIP-seq
MIRT874218	hsa-miR-3120-3p	CLIP-seq
MIRT874219	hsa-miR-3121-3p	CLIP-seq
MIRT874220	hsa-miR-3122	CLIP-seq
MIRT874221	hsa-miR-3133	CLIP-seq
MIRT874222	hsa-miR-3152-5p	CLIP-seq
MIRT874223	hsa-miR-3155	CLIP-seq
MIRT874224	hsa-miR-3155b	CLIP-seq
MIRT874225	hsa-miR-3157-3p	CLIP-seq
MIRT874226	hsa-miR-3157-5p	CLIP-seq
MIRT874227	hsa-miR-3165	CLIP-seq
MIRT874228	hsa-miR-3173-5p	CLIP-seq
MIRT874229	hsa-miR-3178	CLIP-seq
MIRT874230	hsa-miR-3180-5p	CLIP-seq
MIRT874231	hsa-miR-3187-5p	CLIP-seq
MIRT874232	hsa-miR-3190	CLIP-seq
MIRT874233	hsa-miR-3200-5p	CLIP-seq
MIRT874234	hsa-miR-330-3p	CLIP-seq
MIRT874235	hsa-miR-335	CLIP-seq
MIRT874236	hsa-miR-338-5p	CLIP-seq
MIRT874237	hsa-miR-3591-3p	CLIP-seq
MIRT874238	hsa-miR-3612	CLIP-seq
MIRT874239	hsa-miR-3622a-3p	CLIP-seq
MIRT874240	hsa-miR-3622b-3p	CLIP-seq
MIRT874241	hsa-miR-3622b-5p	CLIP-seq
MIRT874242	hsa-miR-3646	CLIP-seq
MIRT874243	hsa-miR-3652	CLIP-seq
MIRT874244	hsa-miR-3653	CLIP-seq
MIRT874245	hsa-miR-3654	CLIP-seq
MIRT874246	hsa-miR-3659	CLIP-seq
MIRT874247	hsa-miR-3665	CLIP-seq
MIRT874248	hsa-miR-3673	CLIP-seq
MIRT874249	hsa-miR-3674	CLIP-seq
MIRT874250	hsa-miR-3689a-3p	CLIP-seq
MIRT874251	hsa-miR-3689c	CLIP-seq
MIRT874252	hsa-miR-372	CLIP-seq
MIRT874253	hsa-miR-373	CLIP-seq
MIRT874254	hsa-miR-377	CLIP-seq
MIRT874255	hsa-miR-381	CLIP-seq
MIRT874256	hsa-miR-3911	CLIP-seq
MIRT874257	hsa-miR-3913-5p	CLIP-seq
MIRT874258	hsa-miR-3915	CLIP-seq
MIRT874259	hsa-miR-3925-5p	CLIP-seq
MIRT874260	hsa-miR-3928	CLIP-seq
MIRT874261	hsa-miR-3929	CLIP-seq
MIRT874262	hsa-miR-3940-3p	CLIP-seq
MIRT874263	hsa-miR-3940-5p	CLIP-seq
MIRT874264	hsa-miR-3942-5p	CLIP-seq
MIRT874265	hsa-miR-3974	CLIP-seq
MIRT874266	hsa-miR-411	CLIP-seq
MIRT874267	hsa-miR-412	CLIP-seq
MIRT874268	hsa-miR-421	CLIP-seq
MIRT874269	hsa-miR-4251	CLIP-seq
MIRT874270	hsa-miR-4253	CLIP-seq
MIRT874271	hsa-miR-4255	CLIP-seq
MIRT874272	hsa-miR-4262	CLIP-seq
MIRT874273	hsa-miR-4272	CLIP-seq
MIRT874274	hsa-miR-4275	CLIP-seq
MIRT874275	hsa-miR-4283	CLIP-seq
MIRT874276	hsa-miR-4297	CLIP-seq
MIRT874277	hsa-miR-4302	CLIP-seq
MIRT874278	hsa-miR-4304	CLIP-seq
MIRT874279	hsa-miR-4310	CLIP-seq
MIRT874280	hsa-miR-4317	CLIP-seq
MIRT874281	hsa-miR-4320	CLIP-seq
MIRT874282	hsa-miR-4329	CLIP-seq
MIRT874283	hsa-miR-4419b	CLIP-seq
MIRT874284	hsa-miR-4422	CLIP-seq
MIRT874285	hsa-miR-4423-5p	CLIP-seq
MIRT874286	hsa-miR-4430	CLIP-seq
MIRT874287	hsa-miR-4433	CLIP-seq
MIRT874288	hsa-miR-4437	CLIP-seq
MIRT874289	hsa-miR-4459	CLIP-seq
MIRT874290	hsa-miR-4474-3p	CLIP-seq
MIRT874291	hsa-miR-4478	CLIP-seq
MIRT874292	hsa-miR-4486	CLIP-seq
MIRT874293	hsa-miR-4496	CLIP-seq
MIRT874294	hsa-miR-4505	CLIP-seq
MIRT874295	hsa-miR-4507	CLIP-seq
MIRT874296	hsa-miR-450b-5p	CLIP-seq
MIRT874297	hsa-miR-4529-3p	CLIP-seq
MIRT874298	hsa-miR-4649-3p	CLIP-seq
MIRT874299	hsa-miR-4652-3p	CLIP-seq
MIRT874300	hsa-miR-4666-3p	CLIP-seq
MIRT874301	hsa-miR-4667-5p	CLIP-seq
MIRT874302	hsa-miR-4670-3p	CLIP-seq
MIRT874303	hsa-miR-4689	CLIP-seq
MIRT874304	hsa-miR-4691-3p	CLIP-seq
MIRT874305	hsa-miR-4699-3p	CLIP-seq
MIRT874306	hsa-miR-4700-5p	CLIP-seq
MIRT874307	hsa-miR-4703-3p	CLIP-seq
MIRT874308	hsa-miR-4703-5p	CLIP-seq
MIRT874309	hsa-miR-4711-5p	CLIP-seq
MIRT874310	hsa-miR-4715-3p	CLIP-seq
MIRT874311	hsa-miR-4722-5p	CLIP-seq
MIRT874312	hsa-miR-4728-5p	CLIP-seq
MIRT874313	hsa-miR-4731-3p	CLIP-seq
MIRT874314	hsa-miR-4736	CLIP-seq
MIRT874315	hsa-miR-4760-5p	CLIP-seq
MIRT874316	hsa-miR-4762-3p	CLIP-seq
MIRT874317	hsa-miR-4763-3p	CLIP-seq
MIRT874318	hsa-miR-4764-5p	CLIP-seq
MIRT874319	hsa-miR-4768-3p	CLIP-seq
MIRT874320	hsa-miR-4773	CLIP-seq
MIRT874321	hsa-miR-4774-3p	CLIP-seq
MIRT874322	hsa-miR-4775	CLIP-seq
MIRT874323	hsa-miR-4778-5p	CLIP-seq
MIRT874324	hsa-miR-4782-5p	CLIP-seq
MIRT874325	hsa-miR-4801	CLIP-seq
MIRT874326	hsa-miR-484	CLIP-seq
MIRT874327	hsa-miR-485-5p	CLIP-seq
MIRT874328	hsa-miR-498	CLIP-seq
MIRT874329	hsa-miR-502-5p	CLIP-seq
MIRT874330	hsa-miR-512-3p	CLIP-seq
MIRT874331	hsa-miR-513c	CLIP-seq
MIRT874332	hsa-miR-514b-5p	CLIP-seq
MIRT874333	hsa-miR-516b	CLIP-seq
MIRT874334	hsa-miR-518d-5p	CLIP-seq
MIRT874335	hsa-miR-519a	CLIP-seq
MIRT874336	hsa-miR-519b-3p	CLIP-seq
MIRT874337	hsa-miR-519b-5p	CLIP-seq
MIRT874338	hsa-miR-519c-3p	CLIP-seq
MIRT874339	hsa-miR-519c-5p	CLIP-seq
MIRT874340	hsa-miR-520a-3p	CLIP-seq
MIRT874341	hsa-miR-520a-5p	CLIP-seq
MIRT874342	hsa-miR-520b	CLIP-seq
MIRT874343	hsa-miR-520c-3p	CLIP-seq
MIRT874344	hsa-miR-520c-5p	CLIP-seq
MIRT874345	hsa-miR-520d-3p	CLIP-seq
MIRT874346	hsa-miR-520e	CLIP-seq
MIRT874347	hsa-miR-522	CLIP-seq
MIRT874348	hsa-miR-525-5p	CLIP-seq
MIRT874349	hsa-miR-526a	CLIP-seq
MIRT874350	hsa-miR-542-5p	CLIP-seq
MIRT874351	hsa-miR-544b	CLIP-seq
MIRT874352	hsa-miR-548a-3p	CLIP-seq
MIRT874353	hsa-miR-548e	CLIP-seq
MIRT874354	hsa-miR-548f	CLIP-seq
MIRT874355	hsa-miR-548l	CLIP-seq
MIRT874356	hsa-miR-548n	CLIP-seq
MIRT874357	hsa-miR-548o	CLIP-seq
MIRT874358	hsa-miR-548p	CLIP-seq
MIRT874359	hsa-miR-548u	CLIP-seq
MIRT874360	hsa-miR-550a	CLIP-seq
MIRT874361	hsa-miR-553	CLIP-seq
MIRT874362	hsa-miR-576-3p	CLIP-seq
MIRT874363	hsa-miR-582-5p	CLIP-seq
MIRT874364	hsa-miR-587	CLIP-seq
MIRT874365	hsa-miR-591	CLIP-seq
MIRT874366	hsa-miR-592	CLIP-seq
MIRT874367	hsa-miR-597	CLIP-seq
MIRT874368	hsa-miR-612	CLIP-seq
MIRT874369	hsa-miR-617	CLIP-seq
MIRT874370	hsa-miR-619	CLIP-seq
MIRT874371	hsa-miR-629	CLIP-seq
MIRT874372	hsa-miR-637	CLIP-seq
MIRT874373	hsa-miR-640	CLIP-seq
MIRT874374	hsa-miR-650	CLIP-seq
MIRT874375	hsa-miR-661	CLIP-seq
MIRT874376	hsa-miR-764	CLIP-seq
MIRT874377	hsa-miR-802	CLIP-seq
MIRT874378	hsa-miR-874	CLIP-seq
MIRT874379	hsa-miR-875-3p	CLIP-seq
MIRT874380	hsa-miR-890	CLIP-seq
MIRT874381	hsa-miR-9	CLIP-seq
MIRT874382	hsa-miR-940	CLIP-seq
MIRT874174	hsa-miR-101	CLIP-seq
MIRT874178	hsa-miR-1207-5p	CLIP-seq
MIRT874179	hsa-miR-122	CLIP-seq
MIRT874181	hsa-miR-1225-3p	CLIP-seq
MIRT1959227	hsa-miR-1228	CLIP-seq
MIRT874182	hsa-miR-1233	CLIP-seq
MIRT874183	hsa-miR-1237	CLIP-seq
MIRT874184	hsa-miR-1243	CLIP-seq
MIRT874186	hsa-miR-1248	CLIP-seq
MIRT1959228	hsa-miR-1257	CLIP-seq
MIRT1959229	hsa-miR-1273	CLIP-seq
MIRT1959230	hsa-miR-1273c	CLIP-seq
MIRT1959231	hsa-miR-1305	CLIP-seq
MIRT1959232	hsa-miR-136	CLIP-seq
MIRT1959233	hsa-miR-142-3p	CLIP-seq
MIRT874195	hsa-miR-144	CLIP-seq
MIRT874197	hsa-miR-1468	CLIP-seq
MIRT1959234	hsa-miR-155	CLIP-seq
MIRT874199	hsa-miR-181a	CLIP-seq
MIRT874200	hsa-miR-181b	CLIP-seq
MIRT874201	hsa-miR-181c	CLIP-seq
MIRT874202	hsa-miR-181d	CLIP-seq
MIRT874203	hsa-miR-1827	CLIP-seq
MIRT1959235	hsa-miR-205	CLIP-seq
MIRT874206	hsa-miR-2052	CLIP-seq
MIRT874207	hsa-miR-2115	CLIP-seq
MIRT1959236	hsa-miR-2116	CLIP-seq
MIRT1959237	hsa-miR-217	CLIP-seq
MIRT1959238	hsa-miR-2682	CLIP-seq
MIRT874209	hsa-miR-298	CLIP-seq
MIRT874210	hsa-miR-300	CLIP-seq
MIRT874217	hsa-miR-3065-5p	CLIP-seq
MIRT1959239	hsa-miR-3117-3p	CLIP-seq
MIRT874218	hsa-miR-3120-3p	CLIP-seq
MIRT874219	hsa-miR-3121-3p	CLIP-seq
MIRT874220	hsa-miR-3122	CLIP-seq
MIRT874222	hsa-miR-3152-5p	CLIP-seq
MIRT874226	hsa-miR-3157-5p	CLIP-seq
MIRT1959240	hsa-miR-3158-5p	CLIP-seq
MIRT1959241	hsa-miR-3174	CLIP-seq
MIRT874232	hsa-miR-3190	CLIP-seq
MIRT874234	hsa-miR-330-3p	CLIP-seq
MIRT874236	hsa-miR-338-5p	CLIP-seq
MIRT874237	hsa-miR-3591-3p	CLIP-seq
MIRT1959242	hsa-miR-3609	CLIP-seq
MIRT1959243	hsa-miR-3611	CLIP-seq
MIRT874242	hsa-miR-3646	CLIP-seq
MIRT874244	hsa-miR-3653	CLIP-seq
MIRT874245	hsa-miR-3654	CLIP-seq
MIRT1959244	hsa-miR-3664-3p	CLIP-seq
MIRT874247	hsa-miR-3665	CLIP-seq
MIRT1959245	hsa-miR-3671	CLIP-seq
MIRT874248	hsa-miR-3673	CLIP-seq
MIRT874249	hsa-miR-3674	CLIP-seq
MIRT1959246	hsa-miR-3688-3p	CLIP-seq
MIRT874250	hsa-miR-3689a-3p	CLIP-seq
MIRT874251	hsa-miR-3689c	CLIP-seq
MIRT1959247	hsa-miR-3692	CLIP-seq
MIRT874255	hsa-miR-381	CLIP-seq
MIRT874256	hsa-miR-3911	CLIP-seq
MIRT874257	hsa-miR-3913-5p	CLIP-seq
MIRT874259	hsa-miR-3925-5p	CLIP-seq
MIRT874261	hsa-miR-3929	CLIP-seq
MIRT874262	hsa-miR-3940-3p	CLIP-seq
MIRT874264	hsa-miR-3942-5p	CLIP-seq
MIRT874265	hsa-miR-3974	CLIP-seq
MIRT874266	hsa-miR-411	CLIP-seq
MIRT874267	hsa-miR-412	CLIP-seq
MIRT874272	hsa-miR-4262	CLIP-seq
MIRT874274	hsa-miR-4275	CLIP-seq
MIRT1959248	hsa-miR-4277	CLIP-seq
MIRT874277	hsa-miR-4302	CLIP-seq
MIRT874281	hsa-miR-4320	CLIP-seq
MIRT1959249	hsa-miR-4418	CLIP-seq
MIRT874283	hsa-miR-4419b	CLIP-seq
MIRT874285	hsa-miR-4423-5p	CLIP-seq
MIRT874287	hsa-miR-4433	CLIP-seq
MIRT874289	hsa-miR-4459	CLIP-seq
MIRT1959250	hsa-miR-4473	CLIP-seq
MIRT874291	hsa-miR-4478	CLIP-seq
MIRT874292	hsa-miR-4486	CLIP-seq
MIRT1959251	hsa-miR-4495	CLIP-seq
MIRT1959252	hsa-miR-449c	CLIP-seq
MIRT1959253	hsa-miR-450b-3p	CLIP-seq
MIRT874298	hsa-miR-4649-3p	CLIP-seq
MIRT1959254	hsa-miR-4649-5p	CLIP-seq
MIRT874299	hsa-miR-4652-3p	CLIP-seq
MIRT874300	hsa-miR-4666-3p	CLIP-seq
MIRT874302	hsa-miR-4670-3p	CLIP-seq
MIRT1959255	hsa-miR-4677-5p	CLIP-seq
MIRT874304	hsa-miR-4691-3p	CLIP-seq
MIRT874305	hsa-miR-4699-3p	CLIP-seq
MIRT874307	hsa-miR-4703-3p	CLIP-seq
MIRT874308	hsa-miR-4703-5p	CLIP-seq
MIRT1959256	hsa-miR-4705	CLIP-seq
MIRT874309	hsa-miR-4711-5p	CLIP-seq
MIRT874311	hsa-miR-4722-5p	CLIP-seq
MIRT874312	hsa-miR-4728-5p	CLIP-seq
MIRT874313	hsa-miR-4731-3p	CLIP-seq
MIRT874314	hsa-miR-4736	CLIP-seq
MIRT874315	hsa-miR-4760-5p	CLIP-seq
MIRT1959257	hsa-miR-4762-5p	CLIP-seq
MIRT874317	hsa-miR-4763-3p	CLIP-seq
MIRT874318	hsa-miR-4764-5p	CLIP-seq
MIRT874319	hsa-miR-4768-3p	CLIP-seq
MIRT874320	hsa-miR-4773	CLIP-seq
MIRT1959258	hsa-miR-4790-3p	CLIP-seq
MIRT1959259	hsa-miR-4793-3p	CLIP-seq
MIRT1959260	hsa-miR-4796-5p	CLIP-seq
MIRT874325	hsa-miR-4801	CLIP-seq
MIRT874327	hsa-miR-485-5p	CLIP-seq
MIRT874328	hsa-miR-498	CLIP-seq
MIRT1959261	hsa-miR-501-5p	CLIP-seq
MIRT1959262	hsa-miR-508-5p	CLIP-seq
MIRT1959263	hsa-miR-509-3-5p	CLIP-seq
MIRT1959264	hsa-miR-509-5p	CLIP-seq
MIRT874330	hsa-miR-512-3p	CLIP-seq
MIRT874331	hsa-miR-513c	CLIP-seq
MIRT874332	hsa-miR-514b-5p	CLIP-seq
MIRT1959265	hsa-miR-520f	CLIP-seq
MIRT874350	hsa-miR-542-5p	CLIP-seq
MIRT874352	hsa-miR-548a-3p	CLIP-seq
MIRT1959266	hsa-miR-548ah	CLIP-seq
MIRT874353	hsa-miR-548e	CLIP-seq
MIRT874354	hsa-miR-548f	CLIP-seq
MIRT874356	hsa-miR-548n	CLIP-seq
MIRT874359	hsa-miR-548u	CLIP-seq
MIRT874360	hsa-miR-550a	CLIP-seq
MIRT874362	hsa-miR-576-3p	CLIP-seq
MIRT874363	hsa-miR-582-5p	CLIP-seq
MIRT874364	hsa-miR-587	CLIP-seq
MIRT874365	hsa-miR-591	CLIP-seq
MIRT874366	hsa-miR-592	CLIP-seq
MIRT874367	hsa-miR-597	CLIP-seq
MIRT1959267	hsa-miR-599	CLIP-seq
MIRT1959268	hsa-miR-607	CLIP-seq
MIRT874370	hsa-miR-619	CLIP-seq
MIRT1959269	hsa-miR-643	CLIP-seq
MIRT1959270	hsa-miR-653	CLIP-seq
MIRT874375	hsa-miR-661	CLIP-seq
MIRT1959271	hsa-miR-758	CLIP-seq
MIRT874376	hsa-miR-764	CLIP-seq
MIRT1959272	hsa-miR-766	CLIP-seq
MIRT1959273	hsa-miR-769-3p	CLIP-seq
MIRT874377	hsa-miR-802	CLIP-seq
MIRT874380	hsa-miR-890	CLIP-seq
MIRT874381	hsa-miR-9	CLIP-seq
MIRT874382	hsa-miR-940	CLIP-seq
MIRT874174	hsa-miR-101	CLIP-seq
MIRT2196254	hsa-miR-10a	CLIP-seq
MIRT2196255	hsa-miR-10b	CLIP-seq
MIRT874175	hsa-miR-1178	CLIP-seq
MIRT874176	hsa-miR-1179	CLIP-seq
MIRT874177	hsa-miR-1206	CLIP-seq
MIRT874178	hsa-miR-1207-5p	CLIP-seq
MIRT874179	hsa-miR-122	CLIP-seq
MIRT874180	hsa-miR-1224-5p	CLIP-seq
MIRT874181	hsa-miR-1225-3p	CLIP-seq
MIRT1959227	hsa-miR-1228	CLIP-seq
MIRT874182	hsa-miR-1233	CLIP-seq
MIRT874183	hsa-miR-1237	CLIP-seq
MIRT874184	hsa-miR-1243	CLIP-seq
MIRT874185	hsa-miR-1246	CLIP-seq
MIRT874186	hsa-miR-1248	CLIP-seq
MIRT1959228	hsa-miR-1257	CLIP-seq
MIRT874188	hsa-miR-1269	CLIP-seq
MIRT874189	hsa-miR-1269b	CLIP-seq
MIRT1959229	hsa-miR-1273	CLIP-seq
MIRT1959230	hsa-miR-1273c	CLIP-seq
MIRT874190	hsa-miR-1285	CLIP-seq
MIRT874192	hsa-miR-1298	CLIP-seq
MIRT874193	hsa-miR-1299	CLIP-seq
MIRT1959231	hsa-miR-1305	CLIP-seq
MIRT874194	hsa-miR-1323	CLIP-seq
MIRT2196256	hsa-miR-133a	CLIP-seq
MIRT2196257	hsa-miR-133b	CLIP-seq
MIRT1959232	hsa-miR-136	CLIP-seq
MIRT1959233	hsa-miR-142-3p	CLIP-seq
MIRT874195	hsa-miR-144	CLIP-seq
MIRT874196	hsa-miR-145	CLIP-seq
MIRT874197	hsa-miR-1468	CLIP-seq
MIRT874198	hsa-miR-146b-3p	CLIP-seq
MIRT1959234	hsa-miR-155	CLIP-seq
MIRT874199	hsa-miR-181a	CLIP-seq
MIRT874200	hsa-miR-181b	CLIP-seq
MIRT874201	hsa-miR-181c	CLIP-seq
MIRT874202	hsa-miR-181d	CLIP-seq
MIRT874203	hsa-miR-1827	CLIP-seq
MIRT2196258	hsa-miR-196a	CLIP-seq
MIRT2196259	hsa-miR-196b	CLIP-seq
MIRT874205	hsa-miR-203	CLIP-seq
MIRT1959235	hsa-miR-205	CLIP-seq
MIRT2196260	hsa-miR-2110	CLIP-seq
MIRT874207	hsa-miR-2115	CLIP-seq
MIRT1959236	hsa-miR-2116	CLIP-seq
MIRT1959237	hsa-miR-217	CLIP-seq
MIRT874208	hsa-miR-2277-5p	CLIP-seq
MIRT2196261	hsa-miR-2681	CLIP-seq
MIRT874209	hsa-miR-298	CLIP-seq
MIRT874210	hsa-miR-300	CLIP-seq
MIRT874211	hsa-miR-302a	CLIP-seq
MIRT874212	hsa-miR-302b	CLIP-seq
MIRT874213	hsa-miR-302c	CLIP-seq
MIRT874214	hsa-miR-302d	CLIP-seq
MIRT874215	hsa-miR-302e	CLIP-seq
MIRT874216	hsa-miR-3064-3p	CLIP-seq
MIRT874217	hsa-miR-3065-5p	CLIP-seq
MIRT1959239	hsa-miR-3117-3p	CLIP-seq
MIRT874218	hsa-miR-3120-3p	CLIP-seq
MIRT874219	hsa-miR-3121-3p	CLIP-seq
MIRT874220	hsa-miR-3122	CLIP-seq
MIRT2196262	hsa-miR-3132	CLIP-seq
MIRT874222	hsa-miR-3152-5p	CLIP-seq
MIRT874223	hsa-miR-3155	CLIP-seq
MIRT874224	hsa-miR-3155b	CLIP-seq
MIRT874225	hsa-miR-3157-3p	CLIP-seq
MIRT874226	hsa-miR-3157-5p	CLIP-seq
MIRT1959240	hsa-miR-3158-5p	CLIP-seq
MIRT874227	hsa-miR-3165	CLIP-seq
MIRT874228	hsa-miR-3173-5p	CLIP-seq
MIRT1959241	hsa-miR-3174	CLIP-seq
MIRT874229	hsa-miR-3178	CLIP-seq
MIRT874230	hsa-miR-3180-5p	CLIP-seq
MIRT2196263	hsa-miR-3187-3p	CLIP-seq
MIRT874231	hsa-miR-3187-5p	CLIP-seq
MIRT874232	hsa-miR-3190	CLIP-seq
MIRT874234	hsa-miR-330-3p	CLIP-seq
MIRT874235	hsa-miR-335	CLIP-seq
MIRT2196264	hsa-miR-338-3p	CLIP-seq
MIRT874236	hsa-miR-338-5p	CLIP-seq
MIRT2196265	hsa-miR-339-5p	CLIP-seq
MIRT2196266	hsa-miR-342-3p	CLIP-seq
MIRT874237	hsa-miR-3591-3p	CLIP-seq
MIRT1959242	hsa-miR-3609	CLIP-seq
MIRT874238	hsa-miR-3612	CLIP-seq
MIRT874239	hsa-miR-3622a-3p	CLIP-seq
MIRT874240	hsa-miR-3622b-3p	CLIP-seq
MIRT874241	hsa-miR-3622b-5p	CLIP-seq
MIRT874242	hsa-miR-3646	CLIP-seq
MIRT874244	hsa-miR-3653	CLIP-seq
MIRT874245	hsa-miR-3654	CLIP-seq
MIRT1959244	hsa-miR-3664-3p	CLIP-seq
MIRT874247	hsa-miR-3665	CLIP-seq
MIRT1959245	hsa-miR-3671	CLIP-seq
MIRT2196267	hsa-miR-3672	CLIP-seq
MIRT874248	hsa-miR-3673	CLIP-seq
MIRT1959246	hsa-miR-3688-3p	CLIP-seq
MIRT874250	hsa-miR-3689a-3p	CLIP-seq
MIRT874251	hsa-miR-3689c	CLIP-seq
MIRT1959247	hsa-miR-3692	CLIP-seq
MIRT874252	hsa-miR-372	CLIP-seq
MIRT874253	hsa-miR-373	CLIP-seq
MIRT874254	hsa-miR-377	CLIP-seq
MIRT874255	hsa-miR-381	CLIP-seq
MIRT874256	hsa-miR-3911	CLIP-seq
MIRT874257	hsa-miR-3913-5p	CLIP-seq
MIRT874258	hsa-miR-3915	CLIP-seq
MIRT874259	hsa-miR-3925-5p	CLIP-seq
MIRT874260	hsa-miR-3928	CLIP-seq
MIRT874261	hsa-miR-3929	CLIP-seq
MIRT874262	hsa-miR-3940-3p	CLIP-seq
MIRT874263	hsa-miR-3940-5p	CLIP-seq
MIRT874264	hsa-miR-3942-5p	CLIP-seq
MIRT874265	hsa-miR-3974	CLIP-seq
MIRT874266	hsa-miR-411	CLIP-seq
MIRT874267	hsa-miR-412	CLIP-seq
MIRT874269	hsa-miR-4251	CLIP-seq
MIRT874270	hsa-miR-4253	CLIP-seq
MIRT874272	hsa-miR-4262	CLIP-seq
MIRT2196268	hsa-miR-4271	CLIP-seq
MIRT874274	hsa-miR-4275	CLIP-seq
MIRT1959248	hsa-miR-4277	CLIP-seq
MIRT2196269	hsa-miR-4282	CLIP-seq
MIRT874275	hsa-miR-4283	CLIP-seq
MIRT874276	hsa-miR-4297	CLIP-seq
MIRT874277	hsa-miR-4302	CLIP-seq
MIRT874278	hsa-miR-4304	CLIP-seq
MIRT874279	hsa-miR-4310	CLIP-seq
MIRT874280	hsa-miR-4317	CLIP-seq
MIRT2196270	hsa-miR-4318	CLIP-seq
MIRT874281	hsa-miR-4320	CLIP-seq
MIRT874282	hsa-miR-4329	CLIP-seq
MIRT1959249	hsa-miR-4418	CLIP-seq
MIRT874283	hsa-miR-4419b	CLIP-seq
MIRT2196271	hsa-miR-4421	CLIP-seq
MIRT874284	hsa-miR-4422	CLIP-seq
MIRT874285	hsa-miR-4423-5p	CLIP-seq
MIRT2196272	hsa-miR-4426	CLIP-seq
MIRT874287	hsa-miR-4433	CLIP-seq
MIRT874288	hsa-miR-4437	CLIP-seq
MIRT874289	hsa-miR-4459	CLIP-seq
MIRT1959250	hsa-miR-4473	CLIP-seq
MIRT2196273	hsa-miR-4477a	CLIP-seq
MIRT874291	hsa-miR-4478	CLIP-seq
MIRT874292	hsa-miR-4486	CLIP-seq
MIRT1959251	hsa-miR-4495	CLIP-seq
MIRT874295	hsa-miR-4507	CLIP-seq
MIRT1959253	hsa-miR-450b-3p	CLIP-seq
MIRT874296	hsa-miR-450b-5p	CLIP-seq
MIRT874297	hsa-miR-4529-3p	CLIP-seq
MIRT2196274	hsa-miR-4529-5p	CLIP-seq
MIRT2196275	hsa-miR-4530	CLIP-seq
MIRT2196276	hsa-miR-4642	CLIP-seq
MIRT2196277	hsa-miR-4647	CLIP-seq
MIRT874298	hsa-miR-4649-3p	CLIP-seq
MIRT1959254	hsa-miR-4649-5p	CLIP-seq
MIRT874299	hsa-miR-4652-3p	CLIP-seq
MIRT2196278	hsa-miR-4662b	CLIP-seq
MIRT874300	hsa-miR-4666-3p	CLIP-seq
MIRT874301	hsa-miR-4667-5p	CLIP-seq
MIRT874302	hsa-miR-4670-3p	CLIP-seq
MIRT1959255	hsa-miR-4677-5p	CLIP-seq
MIRT2196279	hsa-miR-4684-5p	CLIP-seq
MIRT874303	hsa-miR-4689	CLIP-seq
MIRT874304	hsa-miR-4691-3p	CLIP-seq
MIRT2196280	hsa-miR-4693-5p	CLIP-seq
MIRT874305	hsa-miR-4699-3p	CLIP-seq
MIRT874306	hsa-miR-4700-5p	CLIP-seq
MIRT874308	hsa-miR-4703-5p	CLIP-seq
MIRT1959256	hsa-miR-4705	CLIP-seq
MIRT874309	hsa-miR-4711-5p	CLIP-seq
MIRT874310	hsa-miR-4715-3p	CLIP-seq
MIRT2196281	hsa-miR-4717-3p	CLIP-seq
MIRT874311	hsa-miR-4722-5p	CLIP-seq
MIRT2196282	hsa-miR-4725-3p	CLIP-seq
MIRT874312	hsa-miR-4728-5p	CLIP-seq
MIRT874313	hsa-miR-4731-3p	CLIP-seq
MIRT874314	hsa-miR-4736	CLIP-seq
MIRT2196283	hsa-miR-4738-3p	CLIP-seq
MIRT874315	hsa-miR-4760-5p	CLIP-seq
MIRT2196284	hsa-miR-4761-5p	CLIP-seq
MIRT1959257	hsa-miR-4762-5p	CLIP-seq
MIRT874317	hsa-miR-4763-3p	CLIP-seq
MIRT874318	hsa-miR-4764-5p	CLIP-seq
MIRT874319	hsa-miR-4768-3p	CLIP-seq
MIRT874320	hsa-miR-4773	CLIP-seq
MIRT874321	hsa-miR-4774-3p	CLIP-seq
MIRT874324	hsa-miR-4782-5p	CLIP-seq
MIRT1959258	hsa-miR-4790-3p	CLIP-seq
MIRT1959259	hsa-miR-4793-3p	CLIP-seq
MIRT1959260	hsa-miR-4796-5p	CLIP-seq
MIRT874325	hsa-miR-4801	CLIP-seq
MIRT874326	hsa-miR-484	CLIP-seq
MIRT874327	hsa-miR-485-5p	CLIP-seq
MIRT2196285	hsa-miR-490-5p	CLIP-seq
MIRT874328	hsa-miR-498	CLIP-seq
MIRT1959261	hsa-miR-501-5p	CLIP-seq
MIRT874329	hsa-miR-502-5p	CLIP-seq
MIRT1959262	hsa-miR-508-5p	CLIP-seq
MIRT1959263	hsa-miR-509-3-5p	CLIP-seq
MIRT1959264	hsa-miR-509-5p	CLIP-seq
MIRT874330	hsa-miR-512-3p	CLIP-seq
MIRT874331	hsa-miR-513c	CLIP-seq
MIRT874332	hsa-miR-514b-5p	CLIP-seq
MIRT874333	hsa-miR-516b	CLIP-seq
MIRT874334	hsa-miR-518d-5p	CLIP-seq
MIRT874335	hsa-miR-519a	CLIP-seq
MIRT874336	hsa-miR-519b-3p	CLIP-seq
MIRT874337	hsa-miR-519b-5p	CLIP-seq
MIRT874338	hsa-miR-519c-3p	CLIP-seq
MIRT874339	hsa-miR-519c-5p	CLIP-seq
MIRT874340	hsa-miR-520a-3p	CLIP-seq
MIRT874341	hsa-miR-520a-5p	CLIP-seq
MIRT874342	hsa-miR-520b	CLIP-seq
MIRT874343	hsa-miR-520c-3p	CLIP-seq
MIRT874344	hsa-miR-520c-5p	CLIP-seq
MIRT874345	hsa-miR-520d-3p	CLIP-seq
MIRT874346	hsa-miR-520e	CLIP-seq
MIRT1959265	hsa-miR-520f	CLIP-seq
MIRT2196286	hsa-miR-520g	CLIP-seq
MIRT2196287	hsa-miR-520h	CLIP-seq
MIRT874347	hsa-miR-522	CLIP-seq
MIRT874348	hsa-miR-525-5p	CLIP-seq
MIRT874349	hsa-miR-526a	CLIP-seq
MIRT874350	hsa-miR-542-5p	CLIP-seq
MIRT874351	hsa-miR-544b	CLIP-seq
MIRT874352	hsa-miR-548a-3p	CLIP-seq
MIRT1959266	hsa-miR-548ah	CLIP-seq
MIRT874353	hsa-miR-548e	CLIP-seq
MIRT874354	hsa-miR-548f	CLIP-seq
MIRT874357	hsa-miR-548o	CLIP-seq
MIRT874358	hsa-miR-548p	CLIP-seq
MIRT874359	hsa-miR-548u	CLIP-seq
MIRT874360	hsa-miR-550a	CLIP-seq
MIRT874361	hsa-miR-553	CLIP-seq
MIRT2196288	hsa-miR-554	CLIP-seq
MIRT2196289	hsa-miR-556-3p	CLIP-seq
MIRT874362	hsa-miR-576-3p	CLIP-seq
MIRT874363	hsa-miR-582-5p	CLIP-seq
MIRT874364	hsa-miR-587	CLIP-seq
MIRT874365	hsa-miR-591	CLIP-seq
MIRT874366	hsa-miR-592	CLIP-seq
MIRT2196290	hsa-miR-593	CLIP-seq
MIRT2196291	hsa-miR-595	CLIP-seq
MIRT874367	hsa-miR-597	CLIP-seq
MIRT1959267	hsa-miR-599	CLIP-seq
MIRT1959268	hsa-miR-607	CLIP-seq
MIRT874368	hsa-miR-612	CLIP-seq
MIRT874369	hsa-miR-617	CLIP-seq
MIRT874370	hsa-miR-619	CLIP-seq
MIRT874371	hsa-miR-629	CLIP-seq
MIRT874372	hsa-miR-637	CLIP-seq
MIRT1959269	hsa-miR-643	CLIP-seq
MIRT874374	hsa-miR-650	CLIP-seq
MIRT1959270	hsa-miR-653	CLIP-seq
MIRT2196292	hsa-miR-656	CLIP-seq
MIRT874375	hsa-miR-661	CLIP-seq
MIRT2196293	hsa-miR-663b	CLIP-seq
MIRT2196294	hsa-miR-671-5p	CLIP-seq
MIRT874376	hsa-miR-764	CLIP-seq
MIRT1959272	hsa-miR-766	CLIP-seq
MIRT1959273	hsa-miR-769-3p	CLIP-seq
MIRT874377	hsa-miR-802	CLIP-seq
MIRT874378	hsa-miR-874	CLIP-seq
MIRT874379	hsa-miR-875-3p	CLIP-seq
MIRT2196295	hsa-miR-889	CLIP-seq
MIRT874380	hsa-miR-890	CLIP-seq
MIRT2196296	hsa-miR-892a	CLIP-seq
MIRT874381	hsa-miR-9	CLIP-seq
MIRT2196297	hsa-miR-922	CLIP-seq
MIRT874382	hsa-miR-940	CLIP-seq
MIRT874177	hsa-miR-1206	CLIP-seq
MIRT874179	hsa-miR-122	CLIP-seq
MIRT874181	hsa-miR-1225-3p	CLIP-seq
MIRT874182	hsa-miR-1233	CLIP-seq
MIRT874192	hsa-miR-1298	CLIP-seq
MIRT874198	hsa-miR-146b-3p	CLIP-seq
MIRT874203	hsa-miR-1827	CLIP-seq
MIRT874220	hsa-miR-3122	CLIP-seq
MIRT874225	hsa-miR-3157-3p	CLIP-seq
MIRT874227	hsa-miR-3165	CLIP-seq
MIRT874228	hsa-miR-3173-5p	CLIP-seq
MIRT2196266	hsa-miR-342-3p	CLIP-seq
MIRT874239	hsa-miR-3622a-3p	CLIP-seq
MIRT874240	hsa-miR-3622b-3p	CLIP-seq
MIRT874246	hsa-miR-3659	CLIP-seq
MIRT874247	hsa-miR-3665	CLIP-seq
MIRT874248	hsa-miR-3673	CLIP-seq
MIRT874250	hsa-miR-3689a-3p	CLIP-seq
MIRT874251	hsa-miR-3689c	CLIP-seq
MIRT874254	hsa-miR-377	CLIP-seq
MIRT874257	hsa-miR-3913-5p	CLIP-seq
MIRT874261	hsa-miR-3929	CLIP-seq
MIRT874262	hsa-miR-3940-3p	CLIP-seq
MIRT874271	hsa-miR-4255	CLIP-seq
MIRT874277	hsa-miR-4302	CLIP-seq
MIRT874280	hsa-miR-4317	CLIP-seq
MIRT874283	hsa-miR-4419b	CLIP-seq
MIRT874287	hsa-miR-4433	CLIP-seq
MIRT874289	hsa-miR-4459	CLIP-seq
MIRT2196273	hsa-miR-4477a	CLIP-seq
MIRT874291	hsa-miR-4478	CLIP-seq
MIRT2196276	hsa-miR-4642	CLIP-seq
MIRT874298	hsa-miR-4649-3p	CLIP-seq
MIRT874309	hsa-miR-4711-5p	CLIP-seq
MIRT2196281	hsa-miR-4717-3p	CLIP-seq
MIRT874311	hsa-miR-4722-5p	CLIP-seq
MIRT874312	hsa-miR-4728-5p	CLIP-seq
MIRT874314	hsa-miR-4736	CLIP-seq
MIRT874319	hsa-miR-4768-3p	CLIP-seq
MIRT1959260	hsa-miR-4796-5p	CLIP-seq
MIRT874327	hsa-miR-485-5p	CLIP-seq
MIRT874350	hsa-miR-542-5p	CLIP-seq
MIRT874351	hsa-miR-544b	CLIP-seq
MIRT874359	hsa-miR-548u	CLIP-seq
MIRT2196288	hsa-miR-554	CLIP-seq
MIRT874365	hsa-miR-591	CLIP-seq
MIRT2196291	hsa-miR-595	CLIP-seq
MIRT874378	hsa-miR-874	CLIP-seq
MIRT874380	hsa-miR-890	CLIP-seq
MIRT874382	hsa-miR-940	CLIP-seq
MIRT2196254	hsa-miR-10a	CLIP-seq
MIRT2196255	hsa-miR-10b	CLIP-seq
MIRT874181	hsa-miR-1225-3p	CLIP-seq
MIRT874182	hsa-miR-1233	CLIP-seq
MIRT874203	hsa-miR-1827	CLIP-seq
MIRT874220	hsa-miR-3122	CLIP-seq
MIRT874227	hsa-miR-3165	CLIP-seq
MIRT2196265	hsa-miR-339-5p	CLIP-seq
MIRT874238	hsa-miR-3612	CLIP-seq
MIRT874239	hsa-miR-3622a-3p	CLIP-seq
MIRT874240	hsa-miR-3622b-3p	CLIP-seq
MIRT874247	hsa-miR-3665	CLIP-seq
MIRT874250	hsa-miR-3689a-3p	CLIP-seq
MIRT874251	hsa-miR-3689c	CLIP-seq
MIRT874257	hsa-miR-3913-5p	CLIP-seq
MIRT874262	hsa-miR-3940-3p	CLIP-seq
MIRT2196269	hsa-miR-4282	CLIP-seq
MIRT2196271	hsa-miR-4421	CLIP-seq
MIRT874287	hsa-miR-4433	CLIP-seq
MIRT874289	hsa-miR-4459	CLIP-seq
MIRT2196279	hsa-miR-4684-5p	CLIP-seq
MIRT874311	hsa-miR-4722-5p	CLIP-seq
MIRT874312	hsa-miR-4728-5p	CLIP-seq
MIRT874314	hsa-miR-4736	CLIP-seq
MIRT874319	hsa-miR-4768-3p	CLIP-seq
MIRT2446553	hsa-miR-520d-5p	CLIP-seq
MIRT2446554	hsa-miR-524-5p	CLIP-seq
MIRT874351	hsa-miR-544b	CLIP-seq
MIRT2196290	hsa-miR-593	CLIP-seq
MIRT874374	hsa-miR-650	CLIP-seq
MIRT874382	hsa-miR-940	CLIP-seq
MIRT2196254	hsa-miR-10a	CLIP-seq
MIRT2196255	hsa-miR-10b	CLIP-seq
MIRT2196265	hsa-miR-339-5p	CLIP-seq
MIRT2196269	hsa-miR-4282	CLIP-seq
MIRT2196271	hsa-miR-4421	CLIP-seq
MIRT2196279	hsa-miR-4684-5p	CLIP-seq
MIRT2446553	hsa-miR-520d-5p	CLIP-seq
MIRT2446554	hsa-miR-524-5p	CLIP-seq
MIRT2196290	hsa-miR-593	CLIP-seq
MIRT2196254	hsa-miR-10a	CLIP-seq
MIRT2196255	hsa-miR-10b	CLIP-seq
MIRT874178	hsa-miR-1207-5p	CLIP-seq
MIRT874181	hsa-miR-1225-3p	CLIP-seq
MIRT874182	hsa-miR-1233	CLIP-seq
MIRT1959229	hsa-miR-1273	CLIP-seq
MIRT1959230	hsa-miR-1273c	CLIP-seq
MIRT874203	hsa-miR-1827	CLIP-seq
MIRT874220	hsa-miR-3122	CLIP-seq
MIRT874227	hsa-miR-3165	CLIP-seq
MIRT2196265	hsa-miR-339-5p	CLIP-seq
MIRT1959242	hsa-miR-3609	CLIP-seq
MIRT874238	hsa-miR-3612	CLIP-seq
MIRT874239	hsa-miR-3622a-3p	CLIP-seq
MIRT874240	hsa-miR-3622b-3p	CLIP-seq
MIRT874241	hsa-miR-3622b-5p	CLIP-seq
MIRT874247	hsa-miR-3665	CLIP-seq
MIRT874250	hsa-miR-3689a-3p	CLIP-seq
MIRT874251	hsa-miR-3689c	CLIP-seq
MIRT874257	hsa-miR-3913-5p	CLIP-seq
MIRT874261	hsa-miR-3929	CLIP-seq
MIRT874262	hsa-miR-3940-3p	CLIP-seq
MIRT874270	hsa-miR-4253	CLIP-seq
MIRT2196269	hsa-miR-4282	CLIP-seq
MIRT874283	hsa-miR-4419b	CLIP-seq
MIRT2196271	hsa-miR-4421	CLIP-seq
MIRT874287	hsa-miR-4433	CLIP-seq
MIRT874289	hsa-miR-4459	CLIP-seq
MIRT874291	hsa-miR-4478	CLIP-seq
MIRT874292	hsa-miR-4486	CLIP-seq
MIRT874298	hsa-miR-4649-3p	CLIP-seq
MIRT1959254	hsa-miR-4649-5p	CLIP-seq
MIRT2196279	hsa-miR-4684-5p	CLIP-seq
MIRT874311	hsa-miR-4722-5p	CLIP-seq
MIRT874312	hsa-miR-4728-5p	CLIP-seq
MIRT874314	hsa-miR-4736	CLIP-seq
MIRT874317	hsa-miR-4763-3p	CLIP-seq
MIRT874319	hsa-miR-4768-3p	CLIP-seq
MIRT1959259	hsa-miR-4793-3p	CLIP-seq
MIRT874327	hsa-miR-485-5p	CLIP-seq
MIRT1959262	hsa-miR-508-5p	CLIP-seq
MIRT2446553	hsa-miR-520d-5p	CLIP-seq
MIRT2196286	hsa-miR-520g	CLIP-seq
MIRT2196287	hsa-miR-520h	CLIP-seq
MIRT2446554	hsa-miR-524-5p	CLIP-seq
MIRT874351	hsa-miR-544b	CLIP-seq
MIRT1959266	hsa-miR-548ah	CLIP-seq
MIRT874360	hsa-miR-550a	CLIP-seq
MIRT2196290	hsa-miR-593	CLIP-seq
MIRT874374	hsa-miR-650	CLIP-seq
MIRT874375	hsa-miR-661	CLIP-seq
MIRT874376	hsa-miR-764	CLIP-seq
MIRT1959272	hsa-miR-766	CLIP-seq
MIRT874380	hsa-miR-890	CLIP-seq
MIRT874382	hsa-miR-940	CLIP-seq
MIRT2196254	hsa-miR-10a	CLIP-seq
MIRT2196255	hsa-miR-10b	CLIP-seq
MIRT874181	hsa-miR-1225-3p	CLIP-seq
MIRT874182	hsa-miR-1233	CLIP-seq
MIRT874203	hsa-miR-1827	CLIP-seq
MIRT874220	hsa-miR-3122	CLIP-seq
MIRT874227	hsa-miR-3165	CLIP-seq
MIRT2196265	hsa-miR-339-5p	CLIP-seq
MIRT1959242	hsa-miR-3609	CLIP-seq
MIRT874238	hsa-miR-3612	CLIP-seq
MIRT874239	hsa-miR-3622a-3p	CLIP-seq
MIRT874240	hsa-miR-3622b-3p	CLIP-seq
MIRT874247	hsa-miR-3665	CLIP-seq
MIRT2196267	hsa-miR-3672	CLIP-seq
MIRT874250	hsa-miR-3689a-3p	CLIP-seq
MIRT874251	hsa-miR-3689c	CLIP-seq
MIRT874257	hsa-miR-3913-5p	CLIP-seq
MIRT874262	hsa-miR-3940-3p	CLIP-seq
MIRT2196269	hsa-miR-4282	CLIP-seq
MIRT2196271	hsa-miR-4421	CLIP-seq
MIRT874287	hsa-miR-4433	CLIP-seq
MIRT874289	hsa-miR-4459	CLIP-seq
MIRT2196279	hsa-miR-4684-5p	CLIP-seq
MIRT874311	hsa-miR-4722-5p	CLIP-seq
MIRT874312	hsa-miR-4728-5p	CLIP-seq
MIRT874314	hsa-miR-4736	CLIP-seq
MIRT874319	hsa-miR-4768-3p	CLIP-seq
MIRT2446553	hsa-miR-520d-5p	CLIP-seq
MIRT2196286	hsa-miR-520g	CLIP-seq
MIRT2196287	hsa-miR-520h	CLIP-seq
MIRT2446554	hsa-miR-524-5p	CLIP-seq
MIRT874351	hsa-miR-544b	CLIP-seq
MIRT1959266	hsa-miR-548ah	CLIP-seq
MIRT2196290	hsa-miR-593	CLIP-seq
MIRT874374	hsa-miR-650	CLIP-seq
MIRT874382	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ESR1	Repression	18404683

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEP	15174142
GO:0001775	Process	Cell activation	IBA
GO:0001775	Process	Cell activation	IDA	8223854
GO:0001959	Process	Regulation of cytokine-mediated signaling pathway	ISS	16390867
GO:0002237	Process	Response to molecule of bacterial origin	ISS	15493995
GO:0002768	Process	Immune response-regulating cell surface receptor signaling pathway	IC	11313396
GO:0005515	Function	Protein binding	IPI	8753773, 9129046, 15633604, 22731636
GO:0005886	Component	Plasma membrane	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	2153173, 8223854
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	16532032
GO:0016020	Component	Membrane	IDA	10037815
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	NAS	16532032
GO:0016477	Process	Cell migration	ISS	16390867
GO:0019901	Function	Protein kinase binding	IPI	8753773
GO:0022407	Process	Regulation of cell-cell adhesion	IBA
GO:0030296	Function	Protein tyrosine kinase activator activity	IBA
GO:0030296	Function	Protein tyrosine kinase activator activity	IDA	11313396
GO:0030856	Process	Regulation of epithelial cell differentiation	NAS	16930538
GO:0031295	Process	T cell costimulation	IDA	11272271
GO:0032597	Process	B cell receptor transport into membrane raft	IDA	11313396
GO:0032600	Process	Chemokine receptor transport out of membrane raft	ISS
GO:0032913	Process	Negative regulation of transforming growth factor beta3 production	IMP	16930538
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	11272271
GO:0042632	Process	Cholesterol homeostasis	ISS	16390867
GO:0043408	Process	Regulation of MAPK cascade	IDA	11313396
GO:0043627	Process	Response to estrogen	IEP	10037815
GO:0045121	Component	Membrane raft	IBA
GO:0045121	Component	Membrane raft	IDA	11313396
GO:0045730	Process	Respiratory burst	IDA	8223854
GO:0072112	Process	Podocyte differentiation	IMP	19092120
GO:0072139	Process	Glomerular parietal epithelial cell differentiation	IMP	19092120
GO:0097193	Process	Intrinsic apoptotic signaling pathway	NAS	11313396
GO:0098552	Component	Side of membrane	IEA
GO:0098609	Process	Cell-cell adhesion	NAS	15633604
GO:2000768	Process	Positive regulation of nephron tubule epithelial cell differentiation	IMP	16885410

Other IDs

• MIM: 600074
• HGNC: 1645
• e!Ensembl: ENSG00000272398

Protein

• UniProt ID: P25063
• Protein name: Signal transducer CD24 (Small cell lung carcinoma cluster 4 antigen) (CD antigen CD24)
• Protein function: May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-ancho
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14984	CD24	26 → 79	CD24 protein	Family

• Tissue specificity: TISSUE SPECIFICITY: B-cells. Expressed in a number of B-cell lines including P32/ISH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells. {ECO:0000269|PubMed:14657362, ECO:00002
• Sequence:

  MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGG
  ALQSTASLFVVSLSLLHLYS

• Sequence length: 80

Pathways

KEGG:

Efferocytosis
Hematopoietic cell lineage

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	7736776		★☆☆☆☆ Found in Text Mining only
Acute Kidney Tubular Necrosis	Renal tubular necrosis	BEFREE	27871857		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	1375695		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	27203385		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23679566, 24367507, 28369074		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	23331188		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	28611669		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24363164, 29845249		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	26227486		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26078485, 26867566		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	26078485		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	26394139		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12886247		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	25820321, 30657775		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	26372732		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	23720018		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21697762, 27203385, 28369074		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27955675, 30327652	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28461105		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	40551049	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	12829373		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	26900300	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	28065940		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	17411341, 17531534, 20154703, 21960110, 24557789, 25666875, 26245161, 26718436, 28065940		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24557789	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	19852844	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	31054360		★☆☆☆☆ Found in Text Mining only
Behavioral tic	Tourette syndrome	BEFREE	24903673, 28052035		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	16969345		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	23539485	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	25736055		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	25736055	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16488989, 21482678, 30327565		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	30001552	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25820321		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	23813303		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10762644, 16390867, 17062128, 17950993, 18394172, 18404683, 18632604, 19149630, 19528475, 19826050, 19838757, 19895368, 19906290, 19997106, 20019840, 20199686, 20405247, 20470755, 20509143, 20890129, 20940399, 21079774, 21187973, 21196304, 21266162, 21314177, 21338239, 21371176, 21558789, 21633165, 21717460, 21798852, 21835433, 21874052, 21904396, 21915302, 21960110, 22023707, 22037257, 22113945, 22119938, 22127234, 22330142, 22445681, 22480875, 22771536, 22992620, 23012411, 23091114, 23314606, 23500524, 23801032, 23813303, 24075827, 24393851, 24648347, 24754246, 24894672, 25377473, 25445919, 25641732, 25826085, 26201092, 26214774, 26384399, 26444008, 26474458, 26546432, 26797459, 27133070, 27157614, 27259689, 27470135, 28112378, 28179302, 28315505, 28498874, 28716088, 28802177, 29062075, 29257278, 29300112, 29344150, 29416796, 29693159, 29771420, 29843115, 30001552, 30628646, 30664162, 31075227, 31190270, 31367043, 31423948, 31579408		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16524453, 16739331, 16892043, 17229949, 18404683, 18559090, 19048252, 19385591, 19435916, 19488035, 19666588, 19794958, 19899128, 20043317, 20103682, 20199686, 20228222, 20525204, 20691079, 20696077, 20810282, 21187973, 21196304, 21334874, 21338239, 21558789, 21559013, 21666711, 21710320, 21824412, 21935375, 22014860, 22762532, 22791584, 23028444, 23046710, 23320416, 23813303, 23883436, 24167614, 24583601, 24675467, 25269750, 25306216, 25343626, 25445919, 25573951, 25804234, 26091795, 26214774, 26444008, 26474458, 27070671, 27115469, 27738793, 27762298, 27768764, 27837613, 28302531, 28370734, 28716088, 28746471, 28791489, 29178343, 30362671, 30377878, 30450766, 30850363, 31367043, 31545416, 31968657, 33099474, 33170908, 33274565, 33342788, 33390842, 33850163, 33919234, 34360932, 35037689, 35068436, 35999846, 36100762, 37530329, 37893423, 38373689, 39340434, 40587726	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30001552	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34932597	Inhibit	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	27179633		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26351781, 26830684, 28851898	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	1327504, 15532095, 16390867, 17900673, 19130400, 21798852, 22760497, 31614769		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	18559090, 23250778	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	30001552	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	22762532, 30362671	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	21824412, 26617852	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	34293822, 37254618	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21676268, 23651211, 25338637, 27738793, 28671046, 30297396, 30543135, 33230233, 36097402, 39769068	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	27247112	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	23813303	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16488989, 21482678, 30327565, 31213893		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16390867, 17676035, 22592563, 24497554, 29095550		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	12368195, 22652675, 38415537	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27332878, 27414409, 28659655, 30348604, 36142575	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27738793	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23250778	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	23250778, 26797459		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	26227486		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19593703, 23396061, 25969154, 26191160, 28440503, 30317611, 30717444, 31128028		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	29566367	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	31567202		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	40329249	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26707501, 30317240		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26707501, 30317240		★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	34458163	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	25820321, 30657775		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	16125303		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	17436128, 26056085	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	21687942		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	16288985		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	LHGDN	16288985		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	18641983, 24452533, 27248133	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	27738793		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31626945		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26705104	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24557789	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27738793, 29277789, 29956726		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19437567, 26078485	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16890615, 22731636, 24500912, 24696849, 26078485, 27494878, 27784965, 29805687, 30942083, 31614769		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16166435		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	18413748		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22731636, 24696849, 24760019, 26078485, 26097606, 27659530, 27738793, 29053388, 31180548, 31614769, 34396431, 36172359, 38203779	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23533633	Stimulate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	33679693	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	3096564		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27738793, 27812180, 28104442		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21684315, 26019472, 26718436		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	24557789	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	39196303	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	35799782	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	33230233	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesia Familial with Facial Myokymia	Dyskinesia, familial, with facial myokymia	Pubtator	26351781	Stimulate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	18417991		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19130400, 26227486		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	19130400		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	37565251	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37565251	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23396061		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24474454, 31200527		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24474454, 31200527		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24474454, 25212506	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28927233	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	26646713, 30405620	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	38259473	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	32682086	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	12909487, 16084893		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	20567952, 40214364	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	25212506		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	18381780		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	LHGDN	18381780		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17475624		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17475624		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17475624, 19706761	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17475624		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22500096	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25600590, 31032901		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35398668	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	36752779	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	23189166	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28440417, 28827034		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24201869		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	27276062	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12368195, 24952935, 40214364	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	26709788	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	33230233	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30246563, 30361903, 30678441	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	28382140		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	22895640	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	40055671	Associate	★☆☆☆☆ Found in Text Mining only
HYPERTRICHOSIS, CONGENITAL GENERALIZED	HYPERTRICHOSIS	BEFREE	31624236		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25174257, 26372732, 27038472	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26207380, 36097402	Associate	★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	29755476	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20019840, 23801032, 31760908		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19998456, 21684315, 24557789, 26019472		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24557789	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	26386086	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	11063251		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31626945		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	27276062	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	12909487	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	16084893	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27718302, 28118844	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	8874203		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	39867885	Associate	★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Metachromatic	Metachromatic Leukodystrophy	BEFREE	10697958		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19706825, 21676268, 21726833, 24488178, 25338637, 26255089, 26548344, 26608371, 26791237, 27738793, 28383782, 28536738, 28881644, 29844385, 30543135, 30564864, 30778749, 30881025, 30918001, 7553654, 9371521		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	33230233	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	32724082	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19610054, 21726833		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12610508		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21828044, 22592563, 36529523	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17763438, 26968426, 31231380	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31142473	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17411341, 17763438, 20230526, 25666875, 25830931, 30771230		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17411341, 17763438		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20177845, 23046710, 25174257, 28440503, 32168400	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26351781, 26444008, 31128028	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	16424179	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	24201869		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	22369943		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10762644, 16390867, 17062128, 17950993, 18394172, 18404683, 18632604, 19149630, 19435916, 19528475, 19826050, 19838757, 19895368, 19906290, 19997106, 20019840, 20199686, 20405247, 20470755, 20509143, 20890129, 20940399, 21079774, 21187973, 21196304, 21266162, 21314177, 21338239, 21371176, 21558789, 21633165, 21717460, 21798852, 21835433, 21874052, 21904396, 21915302, 21960110, 21984372, 22023707, 22037257, 22113945, 22119938, 22127234, 22330142, 22445681, 22480875, 22771536, 23012411, 23053657, 23091114, 23314606, 23500524, 23801032, 23813303, 24075827, 24393851, 24648347, 24754246, 24894672, 25377473, 25445919, 25641732, 25826085, 26201092, 26214774, 26384399, 26444008, 26474458, 26546432, 26797459, 27133070, 27157614, 27259689, 27470135, 28112378, 28179302, 28315505, 28498874, 28716088, 28802177, 29062075, 29257278, 29300112, 29344150, 29416796, 29693159, 29771420, 29843115, 30001552, 30628646, 30664162, 31075227, 31190270, 31367043, 31423948, 31424661, 31579408		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26227486		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24474454, 31200527		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	19072375		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	29424894		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19610054		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16390867, 17676035, 22592563, 24497554, 29095550		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19593703, 23396061, 25969154, 26191160, 28440503, 30317611, 30717444, 31128028		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18413748, 22322379, 22963768, 23679566, 23679813, 26394139, 27203385, 28659655, 28789349		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	28369074		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18268494, 18752058, 25600590, 25661993, 26712693, 27377469, 27565690, 29300112, 30467381, 30633985		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22839505, 23852892, 24327257, 25174257, 25212506, 25503963, 26900300, 29845783		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16488989, 21482678, 30327565		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11710837, 16488989, 16890615, 17950993, 18268494, 18413748, 19130400, 19149630, 19578743, 19826050, 20154703, 20950370, 21188630, 21266853, 21392411, 21482678, 21835433, 21976680, 22037257, 22369943, 22592563, 22692575, 22760497, 22771536, 22926560, 23143956, 23250778, 23255607, 23396061, 23600676, 23679813, 23813303, 23864708, 23955388, 23974104, 24337682, 24363164, 24391839, 24474454, 24488178, 24835590, 24894672, 24955581, 25174257, 25209720, 25301732, 25736055, 25795715, 25820321, 25823923, 25969154, 26078485, 26227486, 26372732, 26712693, 26744529, 26926234, 27189061, 27203385, 27411517, 27494878, 27630154, 27789195, 27903969, 28121626, 28344048, 28360912, 28391164, 28423035, 28440503, 28536738, 28659655, 28674079, 28687160, 28820056, 28851663, 28866120, 28912624, 28927233, 29062075, 29095550, 29200002, 29277789, 29476980, 29511206, 29528990, 29671949, 29845249, 29845783, 29905375, 30317240, 30317611, 30327565, 30610551, 30628666, 30678233, 30778749, 30881025, 30894512, 30942083, 31200527, 31351482, 31786017		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26707501, 30317240		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27738793, 29277789, 29956726		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16892043, 17540049, 17950993, 18559090		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18404683, 18559090, 19435916, 19895368, 19899128, 20484027, 21187973, 23955388, 24754246, 29771420		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	25820321, 30657775		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	36825029	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29905375, 29928131		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	35409274	Associate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	LHGDN	17944116		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	1830500		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	27179633		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	1830500, 31406992, 31534632		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37815499, 9649209	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14657362, 16631259, 16900767, 17411341, 17475850, 19896210, 21641619, 21815873, 22262195, 25666875, 25830931, 25942344, 26039238, 26718436		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16900767, 17411341		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	19666588, 25130147	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	21815873		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	1701668	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	12447971		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29663362		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24955581, 27647953, 7829271		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	40214364	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12841681, 15305371, 16322224, 16390867, 16488989, 18268494, 18559090, 18632604, 19072375, 19528475, 19593703, 19706825, 19794958, 20019840, 20405247, 20509143, 20525204, 20940399, 21192833, 21304978, 21481528, 21482678, 21536545, 21676268, 21697762, 21726833, 21821672, 21835433, 21976680, 21984372, 21996747, 22119938, 22237177, 22480875, 22692575, 22698401, 22731636, 22760497, 22898897, 22926560, 23091114, 23143956, 23396061, 23504987, 23600676, 23624503, 23679566, 23813303, 23852892, 23955388, 23966295, 24045973, 24488178, 24500912, 24670641, 24835590, 25212506, 25338637, 25351982, 25503963, 25600590, 25892097, 25969154, 26390971, 26444008, 26528725, 26608371, 26707501, 26791237, 26797459, 27179633, 27203385, 27373157, 27402613, 27565690, 27630154, 28104442, 28315505, 28341962, 28382140, 28441454, 28674079, 28785242, 29229854, 29424894, 29671949, 30327565, 30381446, 30543135, 30657775, 30881025, 30942083, 31032901, 31240496, 31367043, 31446534, 31534365, 31760908, 7553654, 9730607		★☆☆☆☆ Found in Text Mining only
Neoplasms, Glandular and Epithelial	Neoplasm	LHGDN	16164042		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	20187302		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	12829373		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29156825, 30044847		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	30044847, 36016357	Associate	★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Multiple sclerosis	Multiple Sclerosis	Orphanet			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29769552		★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	31054360		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24367507		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23801032, 29424894		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 1A	Oculocutaneous albinism	BEFREE	27871857		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	21188630		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	31054360		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27955675	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22870217	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23143956		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	38217543	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	26191160, 32224528	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12368195, 16681720, 17900673		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19593703, 23396061, 25969154, 26191160, 28440503, 30317611, 30717444, 31128028		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12368195, 20952655, 23011824, 24752081, 26191160, 28440503, 30678441, 31128028, 31367043, 32224528, 38030594, 38415537	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24166603	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18413748, 22322379, 22963768, 23679566, 23679813, 26394139, 27203385, 28659655, 28789349		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	28369074	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21697762, 27203385, 28064441		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	27203385		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	28369074		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20426768, 21673909, 22335271, 23679566, 23679813, 24521357, 25176061, 25536077, 26394139, 27748818, 28369074, 37108495	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28659655	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	Pubtator	26546043, 36142575	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28659655		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28687160		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	24681779	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28182766		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	28332730, 31571381, 31701360		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	26394139		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	29335495	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	15654832	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	15654832	Associate	★☆☆☆☆ Found in Text Mining only
Pineal Gland Neoplasm	Pineal Gland Neoplasm	BEFREE	31567202		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	20074564		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31624236		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	1375531		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	12496407		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18268494, 18752058, 25600590, 25661993, 26712693, 27377469, 27565690, 29300112, 30467381, 30633985		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16539730, 18752058, 25661993, 26712693, 27377469, 28758908, 32168400, 33485866, 34019593, 37254618, 37378942	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18752058, 26712693		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	25872416		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28461105		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	29424894		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18384848		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27812180, 28104442		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	22745528	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	23419168, 35848479	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	23600676		★☆☆☆☆ Found in Text Mining only
Sarcoglycanopathies	Sarcoglycanopathies	Pubtator	10397078	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	21086907		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21536545	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	34293822	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30291379		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	1701668	Associate	★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	29983395		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	23250778		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	23250778	Stimulate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27373157, 27738793, 31446534, 7736776, 9797140		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	27738793, 31446534	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23250778, 26926234		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28927233		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19602232, 26647656, 26926234, 27276062, 32986350, 36498950	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28759751		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22839505, 23852892, 24327257, 25174257, 25212506, 25503963, 26900300, 29845783		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20177845, 22839505, 25174257, 26378021, 26830684, 26900300	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25212506	Stimulate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	21961844		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28360912		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37897947, 37907864	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	31790305	Associate	★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	24903673, 28052035		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	22119938		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21334874, 26444008, 26617852, 26963129, 29471829, 29925435, 32546966, 38373689	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21835433, 22309939, 22626806, 23982961, 26444008, 26528725, 26963129, 28266048, 28418843, 29113223, 29471829, 30381446, 30640712, 30894512, 31756533		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24167614, 30001552, 35725558	Stimulate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis 1	Tuberous sclerosis complex	Pubtator	22870217	Inhibit	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis 1	Tuberous sclerosis complex	Pubtator	36231025	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21684315, 26019472, 26718436		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	17284113	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17284113	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40489835	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	37254618	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	30327565		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	27332878	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23318912, 26351781, 32975231	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	12909487, 16084893		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	25376552	Associate	★☆☆☆☆ Found in Text Mining only
VATER association	Vacterl association	Pubtator	19043399	Associate	★☆☆☆☆ Found in Text Mining only