Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10010
Gene name	TRAF family member associated NFKB activator
Gene symbol	TANK
Synonyms (NCBI Gene)	I-TRAFITRAFTRAF2
Chromosome	2
Chromosome location	2q24.2
Summary	The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to

195

Show/Hide all (195)

miRTarBase ID	miRNA	Experiments	Reference
MIRT617696	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT617695	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT617694	hsa-miR-603	HITS-CLIP	21572407
MIRT617692	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT617691	hsa-miR-3941	HITS-CLIP	21572407
MIRT617690	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT707128	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707127	hsa-miR-6083	HITS-CLIP	21572407
MIRT617697	hsa-miR-8485	HITS-CLIP	23824327
MIRT617696	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT617695	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT617694	hsa-miR-603	HITS-CLIP	23824327
MIRT617693	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT617692	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT617691	hsa-miR-3941	HITS-CLIP	23824327
MIRT617690	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT617697	hsa-miR-8485	HITS-CLIP	23824327
MIRT617696	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT617695	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT617694	hsa-miR-603	HITS-CLIP	23824327
MIRT617693	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT617692	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT617691	hsa-miR-3941	HITS-CLIP	23824327
MIRT617690	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT617697	hsa-miR-8485	HITS-CLIP	23824327
MIRT617696	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT617695	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT617694	hsa-miR-603	HITS-CLIP	23824327
MIRT617693	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT617691	hsa-miR-3941	HITS-CLIP	23824327
MIRT617697	hsa-miR-8485	HITS-CLIP	23824327
MIRT617696	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT617695	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT617694	hsa-miR-603	HITS-CLIP	23824327
MIRT617693	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT617692	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT617691	hsa-miR-3941	HITS-CLIP	23824327
MIRT617690	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT726394	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT726393	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT726392	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT726391	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT726390	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT726390	hsa-miR-30e-5p	Luciferase reporter assayImmunoprecipitaion (IP)ELISA	32688283
MIRT617696	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT617695	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT617694	hsa-miR-603	HITS-CLIP	21572407
MIRT617692	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT617691	hsa-miR-3941	HITS-CLIP	21572407
MIRT617690	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT707128	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707127	hsa-miR-6083	HITS-CLIP	21572407
MIRT617697	hsa-miR-8485	HITS-CLIP	23824327
MIRT617696	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT617695	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT617694	hsa-miR-603	HITS-CLIP	23824327
MIRT617693	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT617692	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT617691	hsa-miR-3941	HITS-CLIP	23824327
MIRT617690	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT617697	hsa-miR-8485	HITS-CLIP	23824327
MIRT617696	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT617695	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT617694	hsa-miR-603	HITS-CLIP	23824327
MIRT617693	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT617692	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT617691	hsa-miR-3941	HITS-CLIP	23824327
MIRT617690	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT617697	hsa-miR-8485	HITS-CLIP	23824327
MIRT617696	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT617695	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT617694	hsa-miR-603	HITS-CLIP	23824327
MIRT617693	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT617691	hsa-miR-3941	HITS-CLIP	23824327
MIRT617697	hsa-miR-8485	HITS-CLIP	23824327
MIRT617696	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT617695	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT617694	hsa-miR-603	HITS-CLIP	23824327
MIRT617693	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT617692	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT617691	hsa-miR-3941	HITS-CLIP	23824327
MIRT617690	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT1410572	hsa-miR-106a	CLIP-seq
MIRT1410573	hsa-miR-106b	CLIP-seq
MIRT1410574	hsa-miR-1231	CLIP-seq
MIRT1410575	hsa-miR-1297	CLIP-seq
MIRT1410576	hsa-miR-17	CLIP-seq
MIRT1410577	hsa-miR-20a	CLIP-seq
MIRT1410578	hsa-miR-20b	CLIP-seq
MIRT1410579	hsa-miR-26a	CLIP-seq
MIRT1410580	hsa-miR-26b	CLIP-seq
MIRT1410581	hsa-miR-30a	CLIP-seq
MIRT1410582	hsa-miR-30b	CLIP-seq
MIRT1410583	hsa-miR-30c	CLIP-seq
MIRT1410584	hsa-miR-30d	CLIP-seq
MIRT1410585	hsa-miR-30e	CLIP-seq
MIRT1410586	hsa-miR-3145-3p	CLIP-seq
MIRT1410587	hsa-miR-3159	CLIP-seq
MIRT1410588	hsa-miR-329	CLIP-seq
MIRT1410589	hsa-miR-346	CLIP-seq
MIRT1410590	hsa-miR-3607-3p	CLIP-seq
MIRT1410591	hsa-miR-3609	CLIP-seq
MIRT1410592	hsa-miR-4288	CLIP-seq
MIRT1410593	hsa-miR-4464	CLIP-seq
MIRT1410594	hsa-miR-4465	CLIP-seq
MIRT1410595	hsa-miR-4509	CLIP-seq
MIRT1410596	hsa-miR-4699-3p	CLIP-seq
MIRT1410597	hsa-miR-4744	CLIP-seq
MIRT1410598	hsa-miR-4748	CLIP-seq
MIRT1410599	hsa-miR-4781-3p	CLIP-seq
MIRT1410600	hsa-miR-4795-3p	CLIP-seq
MIRT1410601	hsa-miR-4796-3p	CLIP-seq
MIRT1410602	hsa-miR-519d	CLIP-seq
MIRT1410603	hsa-miR-520d-5p	CLIP-seq
MIRT1410604	hsa-miR-524-5p	CLIP-seq
MIRT1410605	hsa-miR-548ah	CLIP-seq
MIRT1410606	hsa-miR-548c-3p	CLIP-seq
MIRT1410607	hsa-miR-632	CLIP-seq
MIRT1410608	hsa-miR-656	CLIP-seq
MIRT1410609	hsa-miR-93	CLIP-seq
MIRT1410610	hsa-miR-224	CLIP-seq
MIRT1410611	hsa-miR-410	CLIP-seq
MIRT1410612	hsa-miR-4452	CLIP-seq
MIRT1410613	hsa-miR-4775	CLIP-seq
MIRT1410614	hsa-miR-590-3p	CLIP-seq
MIRT1410615	hsa-miR-618	CLIP-seq
MIRT1410587	hsa-miR-3159	CLIP-seq
MIRT1410613	hsa-miR-4775	CLIP-seq
MIRT1410575	hsa-miR-1297	CLIP-seq
MIRT2638381	hsa-miR-190	CLIP-seq
MIRT2638382	hsa-miR-190b	CLIP-seq
MIRT2638383	hsa-miR-203	CLIP-seq
MIRT1410579	hsa-miR-26a	CLIP-seq
MIRT1410580	hsa-miR-26b	CLIP-seq
MIRT2638384	hsa-miR-28-3p	CLIP-seq
MIRT1410586	hsa-miR-3145-3p	CLIP-seq
MIRT2638385	hsa-miR-337-3p	CLIP-seq
MIRT2638386	hsa-miR-3646	CLIP-seq
MIRT2638387	hsa-miR-3685	CLIP-seq
MIRT2638388	hsa-miR-376c	CLIP-seq
MIRT2638389	hsa-miR-384	CLIP-seq
MIRT2638390	hsa-miR-3913-3p	CLIP-seq
MIRT2638391	hsa-miR-3942-5p	CLIP-seq
MIRT1410611	hsa-miR-410	CLIP-seq
MIRT2638392	hsa-miR-421	CLIP-seq
MIRT2638393	hsa-miR-4272	CLIP-seq
MIRT1410612	hsa-miR-4452	CLIP-seq
MIRT1410594	hsa-miR-4465	CLIP-seq
MIRT2638394	hsa-miR-4635	CLIP-seq
MIRT2638395	hsa-miR-4703-5p	CLIP-seq
MIRT2638396	hsa-miR-4709-5p	CLIP-seq
MIRT2638397	hsa-miR-4738-3p	CLIP-seq
MIRT2638398	hsa-miR-4803	CLIP-seq
MIRT2638399	hsa-miR-489	CLIP-seq
MIRT2638400	hsa-miR-499-3p	CLIP-seq
MIRT2638401	hsa-miR-499a-3p	CLIP-seq
MIRT2638402	hsa-miR-548ac	CLIP-seq
MIRT2638403	hsa-miR-548ae	CLIP-seq
MIRT2638404	hsa-miR-548aj	CLIP-seq
MIRT2638405	hsa-miR-548am	CLIP-seq
MIRT2638406	hsa-miR-548d-3p	CLIP-seq
MIRT2638407	hsa-miR-548x	CLIP-seq
MIRT2638408	hsa-miR-548z	CLIP-seq
MIRT1410615	hsa-miR-618	CLIP-seq
MIRT1410575	hsa-miR-1297	CLIP-seq
MIRT2638383	hsa-miR-203	CLIP-seq
MIRT1410579	hsa-miR-26a	CLIP-seq
MIRT1410580	hsa-miR-26b	CLIP-seq
MIRT2638384	hsa-miR-28-3p	CLIP-seq
MIRT1410586	hsa-miR-3145-3p	CLIP-seq
MIRT2638385	hsa-miR-337-3p	CLIP-seq
MIRT2638386	hsa-miR-3646	CLIP-seq
MIRT2638387	hsa-miR-3685	CLIP-seq
MIRT2638389	hsa-miR-384	CLIP-seq
MIRT2638390	hsa-miR-3913-3p	CLIP-seq
MIRT2638391	hsa-miR-3942-5p	CLIP-seq
MIRT2638392	hsa-miR-421	CLIP-seq
MIRT2638393	hsa-miR-4272	CLIP-seq
MIRT1410612	hsa-miR-4452	CLIP-seq
MIRT1410594	hsa-miR-4465	CLIP-seq
MIRT2638394	hsa-miR-4635	CLIP-seq
MIRT2638395	hsa-miR-4703-5p	CLIP-seq
MIRT2638396	hsa-miR-4709-5p	CLIP-seq
MIRT2638397	hsa-miR-4738-3p	CLIP-seq
MIRT2638398	hsa-miR-4803	CLIP-seq
MIRT2638399	hsa-miR-489	CLIP-seq
MIRT2638400	hsa-miR-499-3p	CLIP-seq
MIRT2638401	hsa-miR-499a-3p	CLIP-seq
MIRT2638402	hsa-miR-548ac	CLIP-seq
MIRT2638403	hsa-miR-548ae	CLIP-seq
MIRT2638404	hsa-miR-548aj	CLIP-seq
MIRT2638405	hsa-miR-548am	CLIP-seq
MIRT2638406	hsa-miR-548d-3p	CLIP-seq
MIRT2638407	hsa-miR-548x	CLIP-seq
MIRT2638408	hsa-miR-548z	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004843	Function	Cysteine-type deubiquitinase activity	IMP	25861989
GO:0005515	Function	Protein binding	IPI	12005438, 14743216, 17500595, 17568778, 18307994, 20562859, 21212807, 21653829, 21784977, 21903422, 21931555, 21988832, 24008843, 25416956, 25852190, 25861989, 26638075, 28514442, 29251827, 30561431, 32707033, 32814053, 33961781, 34084167
GO:0005737	Component	Cytoplasm	IDA	21931631
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	25861989
GO:0007165	Process	Signal transduction	TAS	8710854
GO:0008270	Function	Zinc ion binding	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0032481	Process	Positive regulation of type I interferon production	IDA	14703513, 18636090
GO:0032481	Process	Positive regulation of type I interferon production	IDA	21931631
GO:0032991	Component	Protein-containing complex	IDA	25861989
GO:0035800	Function	Deubiquitinase activator activity	IMP	25861989
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	25861989
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	NAS	21931631
GO:0060090	Function	Molecular adaptor activity	IDA	21931631
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	21931631
GO:0071347	Process	Cellular response to interleukin-1	IMP	25861989
GO:0071356	Process	Cellular response to tumor necrosis factor	IMP	25861989
GO:0071479	Process	Cellular response to ionizing radiation	IMP	25861989
GO:0140678	Function	Molecular function inhibitor activity	IEA
GO:1902554	Component	Serine/threonine protein kinase complex	NAS	21931631
GO:1903003	Process	Positive regulation of protein deubiquitination	IMP	25861989
GO:2000158	Process	Positive regulation of ubiquitin-specific protease activity	IMP	25861989

MIM	HGNC	e!Ensembl
603893	11562	ENSG00000136560

Q92844

Protein name

TRAF family member-associated NF-kappa-B activator (TRAF-interacting protein) (I-TRAF)

Protein function

Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining them in a latent state. Blocks TRAF2 binding

PDB

1KZZ , 1L0A , 5H10

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12845	TBD	132 → 186	TBD domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKS
QLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPRK
ETSARSLGSPLLHERGNIEKTFWDLKEEFHKICMLAKAQKDHLSKLNIPDTATETQCSVP
IQCTDKTDKQEALFKPQAKDDINRGAPSITSVTPRGLCRDEEDTSFESLSKFNVKFPPMD
NDSTFLHSTPERPGILSPATSEAVCQEKFNMEFRDNPGNFVKTEETLFEIQGIDPIASAI
QNLKTTDKTKPSNLVNTCIRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGK
AIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH
FNGET

Sequence length

425

Interactions

View interactions

	KEGG		Reactome
	Autophagy - animal NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway Amyotrophic lateral sclerosis Pathways of neurodegeneration - multiple diseases Lipid and atherosclerosis		TICAM1-dependent activation of IRF3/IRF7 TRAF6 mediated IRF7 activation Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (134)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	23624947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18794145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	31168801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	26350399, 27693724, 28456633, 28822984, 31498468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	26350399		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23392805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	22847298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22847298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16951485	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27534557, 32145086, 33483588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	23116200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11207646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16304992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22847298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	26774166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	26774166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	18312353		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	12411322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23743189, 24677135, 26331901, 28774312, 29311633, 30373932, 31666103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23634849, 26317411	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28521610, 35855852, 37081115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25797626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18794145, 26518718, 29975933, 30720226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24740199, 34071938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23301098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37415241	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24740199, 31477831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28284343, 30988281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30988281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12411322, 22711886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23638224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22685297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29763380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26499327, 34257589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28572508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30054040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27388991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	11207646	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24740199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	30373932		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	30373932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	22355661		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	30373932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18794145, 23775076, 28926524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22952576, 23775076, 28926524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18794145, 23775076, 28926524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16304992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33920356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22170762	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28572508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10666192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11144929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23414308, 29763380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23638224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	27388991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	30803155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	11110706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10595933, 21820422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23624947, 28069801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28017612, 28253108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	22225470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	26165383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	22225470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	23286385, 27693724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26165383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38184997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	22847298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	22847298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20516030, 22847298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	22847298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	22847298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26823737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18230756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18981220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19390683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	19843862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	14521460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23743189, 24677135, 26331901, 28774312, 29311633, 30373932, 31666103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28017612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18794145, 26518718, 29975933, 30720226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31477831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15670977, 23392805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28667915, 28855498, 29151113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26823737, 28482378, 31130821, 31473273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18230756, 18794145, 22532625, 22685297, 23691191, 24677135, 28855498, 29844572, 30373932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22685297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11402319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33800494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	28667915, 28855498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	16512826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17692805, 21850048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20053756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23595117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	23595117		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12681357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23868181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18327814, 27036023, 28153771, 28482378, 28667915, 28855498, 28900035, 29311633, 29626124, 29763380, 30349310, 30451787, 31302315, 31303383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29935055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30349310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25811787		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31477831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35950370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15670977, 23392805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23392805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	15670977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23301098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23608757, 29331484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	31681304, 32926429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	31681304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28667915, 28855498, 29151113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19123467, 29151113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28855498	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	31376214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31486084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	12681357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	22711886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36012427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31638203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26823737, 28482378, 31130821, 31473273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26823737, 28972304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29334839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	28471449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	28471449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33879700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35631261, 37093683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	24457966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	24457966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	24457966		★★★★★ ★☆☆☆☆ Found in Text Mining only

TANK (TRAF family member associated NFKB activator)