Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10007
Gene name	Glucosamine-6-phosphate deaminase 1
Gene symbol	GNPDA1
Synonyms (NCBI Gene)	GNP1GNPDAGNPIGPIHLN
Chromosome	5
Chromosome location	5q31.3
Summary	Glucosamine-6-phosphate deaminase (EC 3.5.99.6) is an allosteric enzyme that catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium (Arreola et al., 2003 [PubMed 12965206]).[supplied by OMIM, Jan 2010]

398

Show/Hide all (398)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023004	hsa-miR-124-3p	Microarray	18668037
MIRT023457	hsa-miR-30b-5p	Sequencing	20371350
MIRT025551	hsa-miR-34a-5p	Proteomics	21566225
MIRT025551	hsa-miR-34a-5p	Proteomics	21566225
MIRT442986	hsa-miR-4691-3p	PAR-CLIP	22291592
MIRT442985	hsa-miR-3157-5p	PAR-CLIP	22291592
MIRT442986	hsa-miR-4691-3p	PAR-CLIP	22100165
MIRT442985	hsa-miR-3157-5p	PAR-CLIP	22100165
MIRT442986	hsa-miR-4691-3p	PAR-CLIP	22291592
MIRT442985	hsa-miR-3157-5p	PAR-CLIP	22291592
MIRT442986	hsa-miR-4691-3p	PAR-CLIP	22100165
MIRT442985	hsa-miR-3157-5p	PAR-CLIP	22100165
MIRT1025069	hsa-miR-103a	CLIP-seq
MIRT1025070	hsa-miR-107	CLIP-seq
MIRT1025071	hsa-miR-1257	CLIP-seq
MIRT1025072	hsa-miR-125a-5p	CLIP-seq
MIRT1025073	hsa-miR-125b	CLIP-seq
MIRT1025074	hsa-miR-1271	CLIP-seq
MIRT1025075	hsa-miR-128	CLIP-seq
MIRT1025076	hsa-miR-1290	CLIP-seq
MIRT1025077	hsa-miR-1304	CLIP-seq
MIRT1025078	hsa-miR-1470	CLIP-seq
MIRT1025079	hsa-miR-148a	CLIP-seq
MIRT1025080	hsa-miR-148b	CLIP-seq
MIRT1025081	hsa-miR-150	CLIP-seq
MIRT1025082	hsa-miR-152	CLIP-seq
MIRT1025083	hsa-miR-182	CLIP-seq
MIRT1025084	hsa-miR-1827	CLIP-seq
MIRT1025085	hsa-miR-185	CLIP-seq
MIRT1025086	hsa-miR-1914	CLIP-seq
MIRT1025087	hsa-miR-19a	CLIP-seq
MIRT1025088	hsa-miR-19b	CLIP-seq
MIRT1025089	hsa-miR-2114	CLIP-seq
MIRT1025090	hsa-miR-23a	CLIP-seq
MIRT1025091	hsa-miR-23b	CLIP-seq
MIRT1025092	hsa-miR-23c	CLIP-seq
MIRT1025093	hsa-miR-2467-5p	CLIP-seq
MIRT1025094	hsa-miR-296-5p	CLIP-seq
MIRT1025095	hsa-miR-30a	CLIP-seq
MIRT1025096	hsa-miR-30b	CLIP-seq
MIRT1025097	hsa-miR-30c	CLIP-seq
MIRT1025098	hsa-miR-30d	CLIP-seq
MIRT1025099	hsa-miR-30e	CLIP-seq
MIRT1025100	hsa-miR-3126-5p	CLIP-seq
MIRT1025101	hsa-miR-3134	CLIP-seq
MIRT1025102	hsa-miR-3156-3p	CLIP-seq
MIRT1025103	hsa-miR-3166	CLIP-seq
MIRT1025104	hsa-miR-3167	CLIP-seq
MIRT1025105	hsa-miR-3173-3p	CLIP-seq
MIRT1025106	hsa-miR-3188	CLIP-seq
MIRT1025107	hsa-miR-3607-5p	CLIP-seq
MIRT1025108	hsa-miR-3612	CLIP-seq
MIRT1025109	hsa-miR-3614-5p	CLIP-seq
MIRT1025110	hsa-miR-3647-3p	CLIP-seq
MIRT1025111	hsa-miR-3652	CLIP-seq
MIRT1025112	hsa-miR-3662	CLIP-seq
MIRT1025113	hsa-miR-3664-3p	CLIP-seq
MIRT1025114	hsa-miR-380	CLIP-seq
MIRT1025115	hsa-miR-3913-3p	CLIP-seq
MIRT1025116	hsa-miR-3926	CLIP-seq
MIRT1025117	hsa-miR-3938	CLIP-seq
MIRT1025118	hsa-miR-3975	CLIP-seq
MIRT1025119	hsa-miR-4301	CLIP-seq
MIRT1025120	hsa-miR-4306	CLIP-seq
MIRT1025121	hsa-miR-4316	CLIP-seq
MIRT1025122	hsa-miR-4319	CLIP-seq
MIRT1025123	hsa-miR-4419a	CLIP-seq
MIRT1025124	hsa-miR-4428	CLIP-seq
MIRT1025125	hsa-miR-4430	CLIP-seq
MIRT1025126	hsa-miR-4432	CLIP-seq
MIRT1025127	hsa-miR-4433	CLIP-seq
MIRT1025128	hsa-miR-4459	CLIP-seq
MIRT1025129	hsa-miR-4495	CLIP-seq
MIRT1025130	hsa-miR-4503	CLIP-seq
MIRT1025131	hsa-miR-4505	CLIP-seq
MIRT1025132	hsa-miR-4510	CLIP-seq
MIRT1025133	hsa-miR-4534	CLIP-seq
MIRT1025134	hsa-miR-4644	CLIP-seq
MIRT1025135	hsa-miR-4650-5p	CLIP-seq
MIRT1025136	hsa-miR-4667-3p	CLIP-seq
MIRT1025137	hsa-miR-4688	CLIP-seq
MIRT1025138	hsa-miR-4695-5p	CLIP-seq
MIRT1025139	hsa-miR-4696	CLIP-seq
MIRT1025140	hsa-miR-4698	CLIP-seq
MIRT1025141	hsa-miR-4722-5p	CLIP-seq
MIRT1025142	hsa-miR-4732-3p	CLIP-seq
MIRT1025143	hsa-miR-4768-3p	CLIP-seq
MIRT1025144	hsa-miR-4780	CLIP-seq
MIRT1025145	hsa-miR-4782-5p	CLIP-seq
MIRT1025146	hsa-miR-485-5p	CLIP-seq
MIRT1025147	hsa-miR-486-3p	CLIP-seq
MIRT1025148	hsa-miR-490-3p	CLIP-seq
MIRT1025149	hsa-miR-496	CLIP-seq
MIRT1025150	hsa-miR-510	CLIP-seq
MIRT1025151	hsa-miR-513c	CLIP-seq
MIRT1025152	hsa-miR-514b-5p	CLIP-seq
MIRT1025153	hsa-miR-532-3p	CLIP-seq
MIRT1025154	hsa-miR-539	CLIP-seq
MIRT1025155	hsa-miR-544b	CLIP-seq
MIRT1025156	hsa-miR-548s	CLIP-seq
MIRT1025157	hsa-miR-556-5p	CLIP-seq
MIRT1025158	hsa-miR-629	CLIP-seq
MIRT1025159	hsa-miR-640	CLIP-seq
MIRT1025160	hsa-miR-642a	CLIP-seq
MIRT1025161	hsa-miR-650	CLIP-seq
MIRT1025162	hsa-miR-665	CLIP-seq
MIRT1025163	hsa-miR-670	CLIP-seq
MIRT1025164	hsa-miR-758	CLIP-seq
MIRT1025165	hsa-miR-760	CLIP-seq
MIRT1025166	hsa-miR-765	CLIP-seq
MIRT1025167	hsa-miR-876-5p	CLIP-seq
MIRT1025168	hsa-miR-890	CLIP-seq
MIRT1025169	hsa-miR-96	CLIP-seq
MIRT1025069	hsa-miR-103a	CLIP-seq
MIRT1025070	hsa-miR-107	CLIP-seq
MIRT1025084	hsa-miR-1827	CLIP-seq
MIRT1025108	hsa-miR-3612	CLIP-seq
MIRT1025128	hsa-miR-4459	CLIP-seq
MIRT1025138	hsa-miR-4695-5p	CLIP-seq
MIRT1025161	hsa-miR-650	CLIP-seq
MIRT1025162	hsa-miR-665	CLIP-seq
MIRT1025166	hsa-miR-765	CLIP-seq
MIRT2003980	hsa-miR-1200	CLIP-seq
MIRT2003981	hsa-miR-122	CLIP-seq
MIRT2003982	hsa-miR-134	CLIP-seq
MIRT2003983	hsa-miR-1343	CLIP-seq
MIRT1025079	hsa-miR-148a	CLIP-seq
MIRT1025080	hsa-miR-148b	CLIP-seq
MIRT1025082	hsa-miR-152	CLIP-seq
MIRT1025084	hsa-miR-1827	CLIP-seq
MIRT1025085	hsa-miR-185	CLIP-seq
MIRT2003984	hsa-miR-2115	CLIP-seq
MIRT2003985	hsa-miR-3074-5p	CLIP-seq
MIRT2003986	hsa-miR-3118	CLIP-seq
MIRT2003987	hsa-miR-3124-3p	CLIP-seq
MIRT1025102	hsa-miR-3156-3p	CLIP-seq
MIRT2003988	hsa-miR-3164	CLIP-seq
MIRT1025105	hsa-miR-3173-3p	CLIP-seq
MIRT1025108	hsa-miR-3612	CLIP-seq
MIRT1025110	hsa-miR-3647-3p	CLIP-seq
MIRT1025113	hsa-miR-3664-3p	CLIP-seq
MIRT1025114	hsa-miR-380	CLIP-seq
MIRT2003989	hsa-miR-4269	CLIP-seq
MIRT1025119	hsa-miR-4301	CLIP-seq
MIRT1025120	hsa-miR-4306	CLIP-seq
MIRT2003990	hsa-miR-4311	CLIP-seq
MIRT2003991	hsa-miR-4325	CLIP-seq
MIRT1025124	hsa-miR-4428	CLIP-seq
MIRT1025127	hsa-miR-4433	CLIP-seq
MIRT2003992	hsa-miR-4443	CLIP-seq
MIRT1025128	hsa-miR-4459	CLIP-seq
MIRT1025129	hsa-miR-4495	CLIP-seq
MIRT1025134	hsa-miR-4644	CLIP-seq
MIRT2003993	hsa-miR-4694-3p	CLIP-seq
MIRT1025138	hsa-miR-4695-5p	CLIP-seq
MIRT1025141	hsa-miR-4722-5p	CLIP-seq
MIRT2003994	hsa-miR-4758-3p	CLIP-seq
MIRT1025143	hsa-miR-4768-3p	CLIP-seq
MIRT2003995	hsa-miR-4786-3p	CLIP-seq
MIRT2003996	hsa-miR-4802-5p	CLIP-seq
MIRT2003997	hsa-miR-488	CLIP-seq
MIRT1025149	hsa-miR-496	CLIP-seq
MIRT2003998	hsa-miR-502-5p	CLIP-seq
MIRT1025150	hsa-miR-510	CLIP-seq
MIRT2003999	hsa-miR-516a-3p	CLIP-seq
MIRT1025153	hsa-miR-532-3p	CLIP-seq
MIRT1025154	hsa-miR-539	CLIP-seq
MIRT2004000	hsa-miR-574-5p	CLIP-seq
MIRT2004001	hsa-miR-592	CLIP-seq
MIRT2004002	hsa-miR-597	CLIP-seq
MIRT1025161	hsa-miR-650	CLIP-seq
MIRT1025162	hsa-miR-665	CLIP-seq
MIRT2004003	hsa-miR-671-5p	CLIP-seq
MIRT1025164	hsa-miR-758	CLIP-seq
MIRT1025166	hsa-miR-765	CLIP-seq
MIRT1025069	hsa-miR-103a	CLIP-seq
MIRT1025070	hsa-miR-107	CLIP-seq
MIRT2003980	hsa-miR-1200	CLIP-seq
MIRT2003981	hsa-miR-122	CLIP-seq
MIRT1025074	hsa-miR-1271	CLIP-seq
MIRT2236751	hsa-miR-1286	CLIP-seq
MIRT2003982	hsa-miR-134	CLIP-seq
MIRT2003983	hsa-miR-1343	CLIP-seq
MIRT1025081	hsa-miR-150	CLIP-seq
MIRT1025083	hsa-miR-182	CLIP-seq
MIRT1025084	hsa-miR-1827	CLIP-seq
MIRT1025085	hsa-miR-185	CLIP-seq
MIRT2003984	hsa-miR-2115	CLIP-seq
MIRT1025090	hsa-miR-23a	CLIP-seq
MIRT1025091	hsa-miR-23b	CLIP-seq
MIRT1025092	hsa-miR-23c	CLIP-seq
MIRT2236752	hsa-miR-296-3p	CLIP-seq
MIRT2003985	hsa-miR-3074-5p	CLIP-seq
MIRT1025095	hsa-miR-30a	CLIP-seq
MIRT1025096	hsa-miR-30b	CLIP-seq
MIRT1025097	hsa-miR-30c	CLIP-seq
MIRT1025098	hsa-miR-30d	CLIP-seq
MIRT1025099	hsa-miR-30e	CLIP-seq
MIRT2236753	hsa-miR-3115	CLIP-seq
MIRT2003986	hsa-miR-3118	CLIP-seq
MIRT1025101	hsa-miR-3134	CLIP-seq
MIRT2236754	hsa-miR-3154	CLIP-seq
MIRT2003988	hsa-miR-3164	CLIP-seq
MIRT1025103	hsa-miR-3166	CLIP-seq
MIRT1025105	hsa-miR-3173-3p	CLIP-seq
MIRT2236755	hsa-miR-3175	CLIP-seq
MIRT2236756	hsa-miR-3180-5p	CLIP-seq
MIRT1025108	hsa-miR-3612	CLIP-seq
MIRT2236757	hsa-miR-3617	CLIP-seq
MIRT1025112	hsa-miR-3662	CLIP-seq
MIRT1025113	hsa-miR-3664-3p	CLIP-seq
MIRT2236758	hsa-miR-371-5p	CLIP-seq
MIRT2236759	hsa-miR-371b-5p	CLIP-seq
MIRT1025115	hsa-miR-3913-3p	CLIP-seq
MIRT2003989	hsa-miR-4269	CLIP-seq
MIRT1025120	hsa-miR-4306	CLIP-seq
MIRT2003990	hsa-miR-4311	CLIP-seq
MIRT2003991	hsa-miR-4325	CLIP-seq
MIRT1025124	hsa-miR-4428	CLIP-seq
MIRT1025127	hsa-miR-4433	CLIP-seq
MIRT2236760	hsa-miR-4434	CLIP-seq
MIRT2236761	hsa-miR-4446-5p	CLIP-seq
MIRT1025128	hsa-miR-4459	CLIP-seq
MIRT2236762	hsa-miR-4493	CLIP-seq
MIRT1025130	hsa-miR-4503	CLIP-seq
MIRT2236763	hsa-miR-450b-3p	CLIP-seq
MIRT2236764	hsa-miR-4516	CLIP-seq
MIRT1025133	hsa-miR-4534	CLIP-seq
MIRT1025134	hsa-miR-4644	CLIP-seq
MIRT2003993	hsa-miR-4694-3p	CLIP-seq
MIRT1025138	hsa-miR-4695-5p	CLIP-seq
MIRT1025140	hsa-miR-4698	CLIP-seq
MIRT2236765	hsa-miR-4705	CLIP-seq
MIRT2236766	hsa-miR-4713-3p	CLIP-seq
MIRT1025141	hsa-miR-4722-5p	CLIP-seq
MIRT2236767	hsa-miR-4755-5p	CLIP-seq
MIRT2236768	hsa-miR-4759	CLIP-seq
MIRT1025143	hsa-miR-4768-3p	CLIP-seq
MIRT2003995	hsa-miR-4786-3p	CLIP-seq
MIRT2003997	hsa-miR-488	CLIP-seq
MIRT1025148	hsa-miR-490-3p	CLIP-seq
MIRT2003998	hsa-miR-502-5p	CLIP-seq
MIRT1025150	hsa-miR-510	CLIP-seq
MIRT2003999	hsa-miR-516a-3p	CLIP-seq
MIRT2236769	hsa-miR-520a-5p	CLIP-seq
MIRT2236770	hsa-miR-522	CLIP-seq
MIRT2236771	hsa-miR-525-5p	CLIP-seq
MIRT1025154	hsa-miR-539	CLIP-seq
MIRT2236772	hsa-miR-548a-3p	CLIP-seq
MIRT2236773	hsa-miR-548e	CLIP-seq
MIRT2236774	hsa-miR-548f	CLIP-seq
MIRT1025157	hsa-miR-556-5p	CLIP-seq
MIRT2236775	hsa-miR-561	CLIP-seq
MIRT2004000	hsa-miR-574-5p	CLIP-seq
MIRT2004001	hsa-miR-592	CLIP-seq
MIRT2004002	hsa-miR-597	CLIP-seq
MIRT1025158	hsa-miR-629	CLIP-seq
MIRT2236776	hsa-miR-633	CLIP-seq
MIRT2236777	hsa-miR-638	CLIP-seq
MIRT1025159	hsa-miR-640	CLIP-seq
MIRT2236778	hsa-miR-641	CLIP-seq
MIRT1025161	hsa-miR-650	CLIP-seq
MIRT1025162	hsa-miR-665	CLIP-seq
MIRT2004003	hsa-miR-671-5p	CLIP-seq
MIRT1025164	hsa-miR-758	CLIP-seq
MIRT1025166	hsa-miR-765	CLIP-seq
MIRT2236779	hsa-miR-769-3p	CLIP-seq
MIRT1025169	hsa-miR-96	CLIP-seq
MIRT2003982	hsa-miR-134	CLIP-seq
MIRT2003986	hsa-miR-3118	CLIP-seq
MIRT2003988	hsa-miR-3164	CLIP-seq
MIRT2236755	hsa-miR-3175	CLIP-seq
MIRT2388552	hsa-miR-3189-3p	CLIP-seq
MIRT1025113	hsa-miR-3664-3p	CLIP-seq
MIRT1025127	hsa-miR-4433	CLIP-seq
MIRT1025128	hsa-miR-4459	CLIP-seq
MIRT2236762	hsa-miR-4493	CLIP-seq
MIRT2236763	hsa-miR-450b-3p	CLIP-seq
MIRT2236766	hsa-miR-4713-3p	CLIP-seq
MIRT1025141	hsa-miR-4722-5p	CLIP-seq
MIRT2003994	hsa-miR-4758-3p	CLIP-seq
MIRT1025143	hsa-miR-4768-3p	CLIP-seq
MIRT2003997	hsa-miR-488	CLIP-seq
MIRT1025150	hsa-miR-510	CLIP-seq
MIRT2236777	hsa-miR-638	CLIP-seq
MIRT1025164	hsa-miR-758	CLIP-seq
MIRT2236779	hsa-miR-769-3p	CLIP-seq
MIRT1025069	hsa-miR-103a	CLIP-seq
MIRT2540646	hsa-miR-103b	CLIP-seq
MIRT1025070	hsa-miR-107	CLIP-seq
MIRT2003980	hsa-miR-1200	CLIP-seq
MIRT2540647	hsa-miR-1245b-5p	CLIP-seq
MIRT2540648	hsa-miR-1263	CLIP-seq
MIRT2540649	hsa-miR-129-3p	CLIP-seq
MIRT2540650	hsa-miR-1295	CLIP-seq
MIRT2540651	hsa-miR-141	CLIP-seq
MIRT1025084	hsa-miR-1827	CLIP-seq
MIRT2540652	hsa-miR-200a	CLIP-seq
MIRT2540653	hsa-miR-22	CLIP-seq
MIRT2236752	hsa-miR-296-3p	CLIP-seq
MIRT2003985	hsa-miR-3074-5p	CLIP-seq
MIRT2003987	hsa-miR-3124-3p	CLIP-seq
MIRT2540654	hsa-miR-3127-3p	CLIP-seq
MIRT2540655	hsa-miR-3142	CLIP-seq
MIRT2236754	hsa-miR-3154	CLIP-seq
MIRT2236755	hsa-miR-3175	CLIP-seq
MIRT2388552	hsa-miR-3189-3p	CLIP-seq
MIRT2540656	hsa-miR-320e	CLIP-seq
MIRT2540657	hsa-miR-34a	CLIP-seq
MIRT2540658	hsa-miR-34c-5p	CLIP-seq
MIRT1025108	hsa-miR-3612	CLIP-seq
MIRT2236757	hsa-miR-3617	CLIP-seq
MIRT2540659	hsa-miR-3651	CLIP-seq
MIRT2540660	hsa-miR-3688-5p	CLIP-seq
MIRT2236758	hsa-miR-371-5p	CLIP-seq
MIRT2236759	hsa-miR-371b-5p	CLIP-seq
MIRT2540661	hsa-miR-378g	CLIP-seq
MIRT2540662	hsa-miR-4330	CLIP-seq
MIRT2236760	hsa-miR-4434	CLIP-seq
MIRT2003992	hsa-miR-4443	CLIP-seq
MIRT1025128	hsa-miR-4459	CLIP-seq
MIRT2540663	hsa-miR-4474-3p	CLIP-seq
MIRT2236762	hsa-miR-4493	CLIP-seq
MIRT2540664	hsa-miR-449a	CLIP-seq
MIRT2540665	hsa-miR-449b	CLIP-seq
MIRT2236763	hsa-miR-450b-3p	CLIP-seq
MIRT2236764	hsa-miR-4516	CLIP-seq
MIRT2540666	hsa-miR-4687-5p	CLIP-seq
MIRT2003993	hsa-miR-4694-3p	CLIP-seq
MIRT1025138	hsa-miR-4695-5p	CLIP-seq
MIRT2236766	hsa-miR-4713-3p	CLIP-seq
MIRT2540667	hsa-miR-4763-5p	CLIP-seq
MIRT2003995	hsa-miR-4786-3p	CLIP-seq
MIRT2003996	hsa-miR-4802-5p	CLIP-seq
MIRT2003997	hsa-miR-488	CLIP-seq
MIRT2236770	hsa-miR-522	CLIP-seq
MIRT2236777	hsa-miR-638	CLIP-seq
MIRT2236778	hsa-miR-641	CLIP-seq
MIRT2540668	hsa-miR-645	CLIP-seq
MIRT2540669	hsa-miR-647	CLIP-seq
MIRT1025161	hsa-miR-650	CLIP-seq
MIRT2540670	hsa-miR-661	CLIP-seq
MIRT1025162	hsa-miR-665	CLIP-seq
MIRT2004003	hsa-miR-671-5p	CLIP-seq
MIRT1025166	hsa-miR-765	CLIP-seq
MIRT2236779	hsa-miR-769-3p	CLIP-seq
MIRT2540671	hsa-miR-938	CLIP-seq
MIRT1025069	hsa-miR-103a	CLIP-seq
MIRT2540646	hsa-miR-103b	CLIP-seq
MIRT1025070	hsa-miR-107	CLIP-seq
MIRT2003980	hsa-miR-1200	CLIP-seq
MIRT2540647	hsa-miR-1245b-5p	CLIP-seq
MIRT2540648	hsa-miR-1263	CLIP-seq
MIRT2540649	hsa-miR-129-3p	CLIP-seq
MIRT2540650	hsa-miR-1295	CLIP-seq
MIRT1025084	hsa-miR-1827	CLIP-seq
MIRT2540653	hsa-miR-22	CLIP-seq
MIRT2236752	hsa-miR-296-3p	CLIP-seq
MIRT2003985	hsa-miR-3074-5p	CLIP-seq
MIRT2003987	hsa-miR-3124-3p	CLIP-seq
MIRT2540654	hsa-miR-3127-3p	CLIP-seq
MIRT2540655	hsa-miR-3142	CLIP-seq
MIRT2236754	hsa-miR-3154	CLIP-seq
MIRT2236755	hsa-miR-3175	CLIP-seq
MIRT2388552	hsa-miR-3189-3p	CLIP-seq
MIRT2540656	hsa-miR-320e	CLIP-seq
MIRT1025108	hsa-miR-3612	CLIP-seq
MIRT2236757	hsa-miR-3617	CLIP-seq
MIRT2540659	hsa-miR-3651	CLIP-seq
MIRT2236758	hsa-miR-371-5p	CLIP-seq
MIRT2236759	hsa-miR-371b-5p	CLIP-seq
MIRT2540661	hsa-miR-378g	CLIP-seq
MIRT2236760	hsa-miR-4434	CLIP-seq
MIRT2003992	hsa-miR-4443	CLIP-seq
MIRT1025128	hsa-miR-4459	CLIP-seq
MIRT2236762	hsa-miR-4493	CLIP-seq
MIRT2236763	hsa-miR-450b-3p	CLIP-seq
MIRT2236764	hsa-miR-4516	CLIP-seq
MIRT2540666	hsa-miR-4687-5p	CLIP-seq
MIRT2003993	hsa-miR-4694-3p	CLIP-seq
MIRT1025138	hsa-miR-4695-5p	CLIP-seq
MIRT2236766	hsa-miR-4713-3p	CLIP-seq
MIRT2540667	hsa-miR-4763-5p	CLIP-seq
MIRT2003995	hsa-miR-4786-3p	CLIP-seq
MIRT2003996	hsa-miR-4802-5p	CLIP-seq
MIRT2003997	hsa-miR-488	CLIP-seq
MIRT2236770	hsa-miR-522	CLIP-seq
MIRT2236777	hsa-miR-638	CLIP-seq
MIRT2236778	hsa-miR-641	CLIP-seq
MIRT2540668	hsa-miR-645	CLIP-seq
MIRT2540669	hsa-miR-647	CLIP-seq
MIRT1025161	hsa-miR-650	CLIP-seq
MIRT2540670	hsa-miR-661	CLIP-seq
MIRT1025162	hsa-miR-665	CLIP-seq
MIRT2004003	hsa-miR-671-5p	CLIP-seq
MIRT1025166	hsa-miR-765	CLIP-seq
MIRT2236779	hsa-miR-769-3p	CLIP-seq
MIRT2540671	hsa-miR-938	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004342	Function	Glucosamine-6-phosphate deaminase activity	IBA
GO:0004342	Function	Glucosamine-6-phosphate deaminase activity	IDA	21807125
GO:0004342	Function	Glucosamine-6-phosphate deaminase activity	IEA
GO:0004342	Function	Glucosamine-6-phosphate deaminase activity	IMP	9438414
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0006043	Process	Glucosamine catabolic process	IBA
GO:0006043	Process	Glucosamine catabolic process	IMP	9438414
GO:0006044	Process	N-acetylglucosamine metabolic process	IEA
GO:0006046	Process	N-acetylglucosamine catabolic process	IBA
GO:0006048	Process	UDP-N-acetylglucosamine biosynthetic process	IEA
GO:0006048	Process	UDP-N-acetylglucosamine biosynthetic process	IMP	26887390
GO:0006091	Process	Generation of precursor metabolites and energy	IMP	9438414
GO:0007338	Process	Single fertilization	TAS	9714720
GO:0016787	Function	Hydrolase activity	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0019262	Process	N-acetylneuraminate catabolic process	IBA
GO:0042802	Function	Identical protein binding	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708

MIM	HGNC	e!Ensembl
601798	4417	ENSG00000113552

P46926

Protein name

Glucosamine-6-phosphate deaminase 1 (GlcN6P deaminase 1) (EC 3.5.99.6) (Glucosamine-6-phosphate isomerase 1) (Protein oscillin)

Protein function

Catalyzes the reversible conversion of alpha-D-glucosamine 6-phosphate (GlcN-6P) into beta-D-fructose 6-phosphate (Fru-6P) and ammonium ion, a regulatory reaction step in de novo uridine diphosphate-N-acetyl-alpha-D-glucosamine (UDP-GlcNAc) bios

PDB

1NE7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01182	Glucosamine_iso	8 → 237	Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase	Domain

Sequence

MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGD
LSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDA
FEEKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGELTK
VPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCD
EDATLELKVKTVKYFKGLMLVHNKLVDPLYSIKEKETEKSQSSKKPYSD

Sequence length

289

Interactions

View interactions

	KEGG		Reactome
	Amino sugar and nucleotide sugar metabolism Metabolic pathways		Glycolysis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (174)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	32560738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	31431834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	3476458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	11371164, 28803808, 31030358, 31415279, 631848, 7435496, 9266190, 9856489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	LHGDN	17041899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	CTD_human_DG	8822954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic, Acquired	Anemia	CTD_human_DG	8822954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic, Congenital	Anemia	LHGDN	12737943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic, Congenital	Anemia	BEFREE	30337328, 9616041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic, Congenital Nonspherocytic	Anemia	BEFREE	17041899, 27519939, 30585945, 31030358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Microangiopathic	Anemia	CTD_human_DG	8822954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Neonatal	Anemia	BEFREE	30585945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	29929532	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27022229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	22964479, 28804831, 30208508, 31031764, 31173887, 31227334, 9814697, 9933445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	10705158, 23316019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10441168, 28932086, 30871774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	11896391, 15034067, 15642150, 16106055, 19660107, 21732014, 23354839, 23911657, 24730590, 27488671, 27539357, 28290525, 29127146, 29931580, 29992549 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	16949042, 18311788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16277670, 28067317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	31394311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36835202	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	40118053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10441168, 28932086, 30871774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	23326145	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	25862562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28719914, 31441345		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	19843387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	30269814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10667603, 12374700, 15897878, 16126909, 16204225, 19531650, 21389093, 22480875, 23248119, 28648642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17659439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17690101, 19531650, 21389093, 23248119, 24576828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36246907	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37020316, 39509399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11748469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	35563509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26579829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25096996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29489742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	28384257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic hemolytic anemia	Hemolytic anemia	BEFREE	8822952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	32560738	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19787266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19787266, 26580615, 31258726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25206290, 26580615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	25425496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	28743912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26579829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Familial	Creutzfeldt-Jakob disease	BEFREE	18325785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	20866111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	3476458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate isomerase	Deficiency Of Glucose-6-Phosphate Isomerase	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14508072, 30104894, 31505082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	20866111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29249683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	2041484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29489742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	31431834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27077767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10666680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	28678830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26201353, 26308071, 30836961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31864301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enzymopathy	Enzymopathy	BEFREE	28803808, 31415279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	14566819, 1649192, 17483335, 17925402, 20978190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	19030199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	29875257, 31058531, 31331390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26936801, 30053149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26936801, 30053149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24645841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	27077767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	11823033, 12623835, 1702101, 18544084, 25244093, 29236352, 38288112, 7681703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic anemia due to glucophosphate isomerase deficiency	Hemolytic Anemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOLYTIC ANEMIA, NONSPHEROCYTIC, DUE TO GLUCOSE PHOSPHATE ISOMERASE DEFICIENCY	Hemolytic Anemia	ORPHANET_DG	22782259, 9446754		★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOLYTIC ANEMIA, NONSPHEROCYTIC, DUE TO GLUCOSE PHOSPHATE ISOMERASE DEFICIENCY	Hemolytic Anemia	UNIPROT_DG	28803808, 7989588, 8499925, 8822952, 8822954, 9446754, 9856489		★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOLYTIC ANEMIA, NONSPHEROCYTIC, DUE TO GLUCOSE PHOSPHATE ISOMERASE DEFICIENCY	Hemolytic Anemia	GENOMICS_ENGLAND_DG	4076245, 411100		★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOLYTIC ANEMIA, NONSPHEROCYTIC, DUE TO GLUCOSE PHOSPHATE ISOMERASE DEFICIENCY	Hemolytic Anemia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOLYTIC ANEMIA, NONSPHEROCYTIC, DUE TO GLUCOSE PHOSPHATE ISOMERASE DEFICIENCY	Hemolytic Anemia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	10763942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops Fetalis	BEFREE	469896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	Pubtator	11135054	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxaluria Primary	Hyperoxaluria	Pubtator	11135054	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22590492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12085186, 28067317	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30478344, 36589842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23008153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30516351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29669399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	8695823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	28803808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29883691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jeune syndrome	Jeune syndrome	Pubtator	25996847	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kinsbourne Syndrome	Opsoclonus-myoclonus syndrome	BEFREE	16543530		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24606425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24606425, 7681703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	8639816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	8639816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	7530480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20204408, 24736611, 27232633, 27288297, 30786811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	28363116, 29883633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	10479390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	10479390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10479390, 28667788, 29669399, 30208508, 31187539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	10479390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23400934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29859377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10667603, 12374700, 16204225, 19531650, 21389093, 22480875, 23248119, 28648642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17659439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26201353, 26308071, 30836961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11748469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25096996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21411499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28599497, 30464597, 31118109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12054583, 12517804, 14566819, 19531650, 19787266, 20978190, 21252914, 25195038, 25560237, 26201353, 28039715, 28500945, 28599497, 29129850, 31118109, 31431834 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19787266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17659439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12592373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17659439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17659439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18618109, 35428910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29249683		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE	Mental retardation	BEFREE	28108401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	18328258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	14984368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microangiopathic hemolytic anemia	Microangiopathic hemolytic anemia	CTD_human_DG	8822954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	30861580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	31031764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21903582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27908533		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23316019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15907827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29669439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	32736138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11517932, 11748469, 12054583, 12090469, 14566819, 16126909, 16204225, 1649192, 17483335, 17925402, 19787266, 19816934, 20600070, 20978190, 23027359 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31030358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30457913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonspherocytic hemolytic anemia	Hemolytic Anemia	BEFREE	17041899, 28223188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonspherocytic hemolytic anemia	Hemolytic Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Opsoclonus-Myoclonus Syndrome	Opsoclonus-myoclonus syndrome	BEFREE	16543530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20978190, 23027359		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25096996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25096996, 38186569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21411499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	11688991, 15570012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12085186, 20845477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	10705158, 16529603, 21166881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15475935, 28039715, 31431834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36593912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	11823033, 12135676, 12668126, 14510962, 15759038, 16529603, 17013814, 19686268, 23281097, 23950173, 25244093, 25862562, 26792457, 28630090, 29236350 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	28384257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	15034067, 15642150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	19758193, 28686816, 28734155, 28804831, 30208508, 30923525, 31031764, 31173887, 31227334, 9933445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35918384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11711525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	9579811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11896393, 14508072, 14566819, 15642150, 16137614, 16211246, 16277670, 17611644, 20826128, 20967861, 23480184, 28067317, 29127146, 31297569, 31441345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15290745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	28108401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	15175081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35681439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	31746355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	18028549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28599497, 30464597, 31118109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	23326145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23326145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	28799258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	16137614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	27838012, 28384257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	25862562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34440660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	20424334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Willebrand disease, platelet type	von Willebrand disorder	BEFREE	1911886		★★★★★ ★☆☆☆☆ Found in Text Mining only

GNPDA1 (glucosamine-6-phosphate deaminase 1)